DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and ARY

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster


Alignment Length:322 Identity:124/322 - (38%)
Similarity:188/322 - (58%) Gaps:19/322 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPNFLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMD 65
            :..|...||:|..||:||.||::......:.||..||:.|:||||.|:.|.||.::|.|||.::.
  Fly    36 LMAPKVRLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIK 100

  Fly    66 EGVVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDN-LYPTCP 129
            .|.::|:.:|:|:|||||||.|..||..||..:..||..|::|||||:|:.||...|. |.|...
  Fly   101 MGNISRENIFLTTKLWNTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSG 165

  Fly   130 DTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQ 194
            |..:..  :|||:||||||||||..|:.::||:||||.:|:.|::..:..||||.|:|..|...|
  Fly   166 DELQTV--EIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVEIWPGFLQ 228

  Fly   195 KPLITLCYDNAIAVTAYSCLG----SGHTP--YEKPGAYPLLQHPTILAIAEKYERTAAQVLLRF 253
            |.|:..|..|.|.|||:|.||    ..|.|  :...|         :..:.:||:|:|:|::||:
  Fly   229 KDLVDYCRYNGIIVTAFSPLGQPNRKNHCPVYFFSEG---------MKRLVKKYKRSASQIVLRY 284

  Fly   254 QTQSGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPFE 315
            ....|::.||::.:..|:.:|. .|:||:|...|.:.:..:....|.:..:....|..:|||
  Fly   285 LIDYGVVPIPKAANPIHIKENL-NIFDFKLDEADTRLLRGIKPKSRIVKYEIVKDHMFYPFE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 119/305 (39%)
Tas 17..293 CDD:223739 113/282 (40%)
ARYNP_001163844.1 ARA1 37..332 CDD:223729 120/306 (39%)
Tas 50..324 CDD:223739 114/285 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468208
Domainoid 1 1.000 211 1.000 Domainoid score I1629
eggNOG 1 0.900 - - E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm1169
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
109.750

Return to query results.
Submit another query.