DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1c14

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_612556.1 Gene:Akr1c14 / 191574 RGDID:708361 Length:322 Species:Rattus norvegicus


Alignment Length:315 Identity:127/315 - (40%)
Similarity:197/315 - (62%) Gaps:13/315 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEVVT-----QAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEG 67
            |::|..:|:||.||  :.||.|.     :|.|.|||.|:||||.|::|..|.:||.|:|.|:::|
  Rat    10 LNDGNFIPVLGFGT--TVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDG 72

  Fly    68 VVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTN 132
            .|.|:::|.|||||:|.|:|:|||...|.::::..:.|::||::|:|||.:.| |..:|. .:..
  Rat    73 TVKREDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPG-DIFFPR-DEHG 135

  Fly   133 KAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQK 195
            |..||.:|..|||.|||...|.||.::|||||||.:|:.|:|:.  .|.|||..|:|||.||:|.
  Rat   136 KLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQS 200

  Fly   196 PLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYP-LLQHPTILAIAEKYERTAAQVLLRFQTQSGI 259
            .::..|....|.:.:|..|||...........| ||..|.:.|||:||::|.|.|.||:|.|.|:
  Rat   201 KMLDYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQRGV 265

  Fly   260 IVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            :.:.||.:.:. :....::::|:||.:|::|::.|:.|.|:...|....||:|||
  Rat   266 VPLIRSFNAKR-IKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYFDDHPNHPF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 120/299 (40%)
Tas 17..293 CDD:223739 115/283 (41%)
Akr1c14NP_612556.1 AKR_AKR1C1-35 7..308 CDD:381334 121/302 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.