DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and C07D8.5

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_509243.1 Gene:C07D8.5 / 182366 WormBaseID:WBGene00015564 Length:134 Species:Caenorhabditis elegans


Alignment Length:75 Identity:38/75 - (50%)
Similarity:50/75 - (66%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRD 72
            |||..:||.:|||||:|..|.|..|||.|:..||...|.|..|.||..:|.|::|.:.||||.|:
 Worm    50 LSNAHSMPAVGLGTWQSNAEDVISAVKAAVKNGYSLIDTASGYNNEEFIGTAIKEVIAEGVVKRE 114

  Fly    73 ELFITSKLWN 82
            :||||:|:.|
 Worm   115 DLFITTKVPN 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 38/75 (51%)
Tas 17..293 CDD:223739 33/66 (50%)
C07D8.5NP_509243.1 AKR_SF 45..>126 CDD:382030 38/75 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166068
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.