DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and C01G5.5

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_500993.1 Gene:C01G5.5 / 182074 WormBaseID:WBGene00015307 Length:287 Species:Caenorhabditis elegans


Alignment Length:292 Identity:91/292 - (31%)
Similarity:152/292 - (52%) Gaps:22/292 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVT 70
            |.|.||:.:|.|.|||:.:..:.:..||.:|:.:|||.||.|..|.||..:|.||:..:....:.
 Worm     2 FKLKNGQEIPKLALGTYEAKGDQLFAAVDEALKVGYRSFDTAKYYENEKDLGLALKTLLPRHNIC 66

  Fly    71 RDELFITSKL--WNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNK 133
            .:::::|||:  :::.:..:|:|.....|:..|..|||:|.|:|:|....:...|      :.||
 Worm    67 SEDIYLTSKVFPYSSKNAAELIRKDVNESLELLDRKYLDLVLVHYPRPLDTEDLN------ENNK 125

  Fly   134 AAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQKPLI 198
            ...:     |||.|:|.|..||..::|||||:....:..:.|...::|.|.|||.||:..:|.|.
 Worm   126 MYRK-----DTWIALEKLHAEGKIRSIGVSNYEPHHIEEMRSYITIEPQVNQIEYHPHFQRKVLR 185

  Fly   199 TLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIP 263
            ..|..|.|...|:|.||.|:.        .||...|:..||..::.|.|.|:|.:..:....|:.
 Worm   186 AYCNKNEILFQAFSPLGRGNK--------TLLGDSTMERIALCHKTTVANVILAWIMKGKYGVVA 242

  Fly   264 RSVSKQHMLDNFKRIWDFELAVDDIQAINELD 295
            :||:...:.:|:..: ..||:.|:.:.||.|:
 Worm   243 KSVTPSRVAENYTSL-SLELSDDEFEKINGLN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 91/292 (31%)
Tas 17..293 CDD:223739 84/277 (30%)
C01G5.5NP_500993.1 AKR_AKR1-5-like 10..270 CDD:381297 84/279 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166040
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.