DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and C07D8.6

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_509242.1 Gene:C07D8.6 / 180997 WormBaseID:WBGene00015565 Length:317 Species:Caenorhabditis elegans


Alignment Length:328 Identity:117/328 - (35%)
Similarity:177/328 - (53%) Gaps:24/328 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STPNFLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDE 66
            :|.:..||||..||::|||||:|.|..|..|||.|:..|||..|.|.:|.||..:|.|::|.::|
 Worm     4 ATASIKLSNGVEMPVIGLGTWQSSPAEVITAVKTAVKAGYRLIDTASVYQNEEAIGTAIKELLEE 68

  Fly    67 GVVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDT 131
            |||.|:|||||:|.|.....|..:......|::.|.::|::|||.|.|.|:..          |.
 Worm    69 GVVKREELFITTKAWTHELAPGKLEGGLRESLKKLQLEYVDLYLAHMPAAFND----------DM 123

  Fly   132 NKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPV-VLQIECHPYLSQK 195
            ::.....::  |.||..:.:...||.:|:||||:|..|::|.|::. |.|| ..|:|.|.|..|.
 Worm   124 SEHIASPVE--DVWRQFDAVYKAGLAKAVGVSNWNNDQISRALALG-LTPVHNSQVELHLYFPQH 185

  Fly   196 PLITLCYDNAIAVTAYSCLGS-GHTPYEKPGAYPL--------LQHPTILAIAEKYERTAAQVLL 251
            ..:..|..:.|:||:|:.||| |...:..|....|        ||...:||:|||..:|.|||||
 Worm   186 DHVDFCKKHNISVTSYATLGSPGRVNFTLPTGQKLDWAPAPSDLQDQNVLALAEKTHKTPAQVLL 250

  Fly   252 RFQTQSGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPFEP 316
            |:....|..::|:|:.:..:.:||: ::||.|..:||..:.|...:.|........|||...|..
 Worm   251 RYALDRGCAILPKSIQENRIKENFE-VFDFSLTEEDIAKLEESKNSQRLFLQDFMTGHPEDAFAA 314

  Fly   317 KAK 319
            :.|
 Worm   315 ERK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 111/307 (36%)
Tas 17..293 CDD:223739 103/285 (36%)
C07D8.6NP_509242.1 AKR_AKR1G1_CeAKR 5..301 CDD:381380 112/309 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166067
Domainoid 1 1.000 211 1.000 Domainoid score I1629
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.