DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and exc-15

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001367925.1 Gene:exc-15 / 178844 WormBaseID:WBGene00020369 Length:333 Species:Caenorhabditis elegans


Alignment Length:324 Identity:121/324 - (37%)
Similarity:185/324 - (57%) Gaps:15/324 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPNFLLSNGKNMPMLGLGTWRSPPEV-VTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKM 64
            |:..:..|:.|..:|:.|||||:...|. :|.|::.|:|.|||..|.||:|.||..:|..|.|.:
 Worm     1 MTVDSIPLNTGAQLPLFGLGTWQVKDEAELTVALRAALDAGYRLIDTAHLYQNEHIIGKVLHEYI 65

  Fly    65 DEGVVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCP 129
            ..|.:.|:::|:||||..|.|.|:.|....|:.::.|.::|::|||:|.|..:|....:..|.. 
 Worm    66 SSGKLKREDIFVTSKLPFTAHAPEDVPKCVESQLKALQLEYIDLYLIHCPFPFKHQEGSFAPLM- 129

  Fly   130 DTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQ 194
            :..:.|..:|.::|||||:|.|..||..:|:|||||:..|:..|...|::||...|:|||.|..|
 Worm   130 ENGELAVTEIAHIDTWRALEKLYKEGKLKALGVSNFSCNQLQALYDAAEVKPANQQVECHIYWPQ 194

  Fly   195 KPLITLCYDNAIAVTAYSCLGSGHTPYEK--------PGAYPLLQHPTILAIAEKYERTAAQVLL 251
            :.|..||....:.||||:.|||   |..|        |...|||: |.:..:|.||.:||||:|:
 Worm   195 QELRALCKKLGVTVTAYAPLGS---PGRKAARPDGVWPEGDPLLE-PIVKQLAAKYHKTAAQILI 255

  Fly   252 RFQTQSGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPFE 315
            |..||.||..||:|||...:::|.. .:||:|:.:|:..:|.::...|......|..||..|.:
 Worm   256 RHLTQHGISTIPKSVSPDRIVENIS-TFDFKLSDEDMHTLNSIETRTRLFIADFAVKHPFFPHD 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 116/307 (38%)
Tas 17..293 CDD:223739 111/284 (39%)
exc-15NP_001367925.1 AKR_AKR1G1_CeAKR 3..306 CDD:381380 116/308 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.