DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and C35D10.6

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_498011.1 Gene:C35D10.6 / 175645 WormBaseID:WBGene00016443 Length:287 Species:Caenorhabditis elegans


Alignment Length:280 Identity:96/280 - (34%)
Similarity:147/280 - (52%) Gaps:20/280 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NMPMLGLGTWRSPPEVVTQAVKDA-IDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRDELFI 76
            |||::|:|||:...|.:.:.|.|| ...|||..|.|.:|.|||::|..|.:.:....:.|::::|
 Worm    10 NMPLIGIGTWQVQKEEILRQVIDAGFKEGYRFIDTAQVYNNEAKIGRILEKLLPANGLKREDIWI 74

  Fly    77 TSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKAAFEDIDY 141
            ||||..::......|.:.|.|:.||.|:||:|.|:|||     || :|....|...|..      
 Worm    75 TSKLAPSNAGVKKARESIEESLSNLKVEYLDLLLIHWP-----GS-SLKSENPANKKLR------ 127

  Fly   142 VDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQKPLITLCYDNAI 206
            |::|..|..::.||..:::|||||....:..|...:.:.|.|.|:|.||:..|..|:..|.:|.|
 Worm   128 VESWNVMCEMMAEGKLRSVGVSNFEICHLEELKKDSNVVPAVNQVEYHPHFHQDDLVKYCNENNI 192

  Fly   207 AVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIPRSVSKQHM 271
            ...|||.|||  ..|.|    .|.:.|.|..:|:||......:||.|....||.|:||:.:.:|:
 Worm   193 HFQAYSSLGS--PTYRK----QLSEEPLIKELAQKYNVEIPVLLLGFAYCQGISVLPRTTNPEHV 251

  Fly   272 LDNFKRIWDFELAVDDIQAI 291
            ..||| :....:..:||..:
 Worm   252 ATNFK-VTKLAITQEDIDRL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 96/280 (34%)
Tas 17..293 CDD:223739 93/276 (34%)
C35D10.6NP_498011.1 AKR_DrGR-like 11..273 CDD:381362 95/279 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.