DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1b3

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_033788.3 Gene:Akr1b3 / 11677 MGIID:1353494 Length:316 Species:Mus musculus


Alignment Length:317 Identity:153/317 - (48%)
Similarity:203/317 - (64%) Gaps:21/317 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRD 72
            |:||..||.||||||:|||..||:|||.|||:||||.|||.:|.||.:||.||:||:.|.||.|.
Mouse     7 LNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDLGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQ 71

  Fly    73 ELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSD--------NLYPTCP 129
            :|||.||||.|.|...:|:.|.:.::.:|.:.||:|||:|||..:|.|.|        |:.|:  
Mouse    72 DLFIVSKLWCTFHDKSMVKGAFQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPS-- 134

  Fly   130 DTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYL 192
                    |.|:||||.|||.||||||.:.|||||||..|:.|:|:.  .|.||.|.||||||||
Mouse   135 --------DTDFVDTWTAMEQLVDEGLVKTIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYL 191

  Fly   193 SQKPLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQS 257
            :|:.||..|:...|.|||||.|||...|:.||....||:.|.|.|||.||.:|.||||:||..|.
Mouse   192 TQEKLIEYCHSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPIQR 256

  Fly   258 GIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            .::|||:||:...:.:|.| ::|||::.:|:..:...:.|.|...:.:...|..:||
Mouse   257 NLVVIPKSVTPVRIAENLK-VFDFEVSSEDMATLLSYNRNWRVCALMSCAKHKDYPF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 149/301 (50%)
Tas 17..293 CDD:223739 143/285 (50%)
Akr1b3NP_033788.3 ARA1 1..297 CDD:223729 149/300 (50%)
Tas 8..289 CDD:223739 147/291 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.