DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1b7

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_038962847.1 Gene:Akr1b7 / 116463 RGDID:620257 Length:329 Species:Rattus norvegicus


Alignment Length:286 Identity:133/286 - (46%)
Similarity:188/286 - (65%) Gaps:9/286 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRDELFITSKLWNTHHKP 87
            ||||..|.:|||.|||.||||||||::|.||::||.|::||:.|..|.|::|||.||||:|..:.
  Rat    35 RSPPGQVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSKLWSTFFEK 99

  Fly    88 DLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNKAAFEDIDYVDTWRAMENLV 152
            .|::.|.:.::.:|.:.||:|||:|||...::|.:.| |. ....|.......::|.|..||.||
  Rat   100 SLMKEAFQKTLSDLKLDYLDLYLIHWPQGLQAGKEFL-PK-DSQGKVLMSKSTFLDAWEGMEELV 162

  Fly   153 DEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYLSQKPLITLCYDNAIAVTAYSCLG 215
            |:||.:|:||||||..|:.|||:.  .|.|||..|:||||||:|:.||..|:...|||.|||.||
  Rat   163 DQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIAVIAYSPLG 227

  Fly   216 SGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVIPRSVSKQHMLDNFKRIWD 280
            |...||.||....:|:.|.|..||.|:::|.||||:||..|..:.|||:||:..|:.:|. :::|
  Rat   228 SPDRPYAKPEDPVVLEIPKIKEIAAKHKKTIAQVLIRFHVQRNVAVIPKSVTLSHIKENI-QVFD 291

  Fly   281 FELAVDDIQAINELDCN----GRFMT 302
            |:|:.:|:.||..|:.|    |.|:|
  Rat   292 FQLSEEDMAAILSLNRNWRACGLFVT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 131/282 (46%)
Tas 17..293 CDD:223739 128/271 (47%)
Akr1b7XP_038962847.1 AKR_SF 35..329 CDD:412396 133/286 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352392
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.