DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and Akr1c14

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_598833.1 Gene:Akr1c14 / 105387 MGIID:2145458 Length:323 Species:Mus musculus


Alignment Length:318 Identity:126/318 - (39%)
Similarity:197/318 - (61%) Gaps:9/318 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TPNFLLSNGKNMPMLGLGTW---RSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKM 64
            :|..:|::|..:|.||.||.   :.|.:.:.:|.|.|||.|:||||.|::|..|.:||.|:|.|:
Mouse     5 SPRVVLNDGHFIPALGFGTTVPDKVPKDELIKATKIAIDTGFRHFDSAYLYQIEEEVGQAIRSKI 69

  Fly    65 DEGVVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCP 129
            ::|.|.|:::|.|||||:|.|:|:|||...|.:::|..:.|::||::|:|||.:.| |.|:|. .
Mouse    70 EDGTVKREDIFYTSKLWSTFHRPELVRSCLEKTLKNAQLDYVDLYIIHFPMALQPG-DKLFPR-D 132

  Fly   130 DTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSV--AKLKPVVLQIECHPYL 192
            :..|...|.:|..|||.|||...|.||.::|||||||.:|:..:|:.  .|.|||..|:|||.||
Mouse   133 EHGKLLAEAVDLCDTWEAMEKCKDAGLAKSIGVSNFNFRQLETILNKPGLKYKPVCNQVECHLYL 197

  Fly   193 SQKPLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYP-LLQHPTILAIAEKYERTAAQVLLRFQTQ 256
            :|..::..|....|.:.:|..|||...........| ||..|.:.|:|.||::|.|.:.:|:|.|
Mouse   198 NQSQMLDYCKSKDIILVSYCTLGSSRDKIWVDQKSPVLLDDPVLCAMANKYKQTPALIAIRYQLQ 262

  Fly   257 SGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYGHPHHPF 314
            .||:|:.||. |:..:..|.::::|:||.:|::.::.|..|.|:.|......||:|||
Mouse   263 RGIVVLTRSF-KEKRIKEFMKVFEFQLASEDMKVLDGLHRNLRYNTASYFDDHPNHPF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 119/302 (39%)
Tas 17..293 CDD:223739 113/281 (40%)
Akr1c14NP_598833.1 AKR_AKR1C1-35 6..308 CDD:381334 120/304 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.