DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6083 and AKR1A1

DIOPT Version :9

Sequence 1:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001189342.1 Gene:AKR1A1 / 10327 HGNCID:380 Length:325 Species:Homo sapiens


Alignment Length:324 Identity:147/324 - (45%)
Similarity:212/324 - (65%) Gaps:13/324 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTPNFLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMD 65
            |:....||..|:.||::|||||:|.|..|..|||.|:.:||||.|||.|||||.::|.||:|.:.
Human     1 MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVG 65

  Fly    66 EG-VVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCP 129
            .| .|.|:|||:|||||||.|.|:.|.||...::.:|.::||:|||||||.|::.| ||.:|...
Human    66 PGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERG-DNPFPKNA 129

  Fly   130 DTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQ 194
            | ....::...|.:||:|:|.||.:||.||:|:||||.:|::.:||||.::|.|||:||||||:|
Human   130 D-GTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQ 193

  Fly   195 KPLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGI 259
            ..||..|....:.|||||.|||....:..|....||:.|.:||:||||.|:.||:|||:|.|..:
Human   194 NELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKV 258

  Fly   260 IVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMT---------MKAAYGHPHHPF 314
            |.||:|::...:|.|.| ::||..:.::::.:|.|:.|.|::.         :....|||.:||
Human   259 ICIPKSITPSRILQNIK-VFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6083NP_648485.1 ARA1 1..300 CDD:223729 141/299 (47%)
Tas 17..293 CDD:223739 132/276 (48%)
AKR1A1NP_001189342.1 ARA1 6..303 CDD:223729 141/299 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - oto88543
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.