DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and AKR1C3

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001240837.1 Gene:AKR1C3 / 8644 HGNCID:386 Length:323 Species:Homo sapiens


Alignment Length:318 Identity:156/318 - (49%)
Similarity:216/318 - (67%) Gaps:10/318 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CL---DGNEIPVIGLGTF---NSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKE 100
            ||   ||:.:||:|.||:   ..|:.:..|..|:||:||:||||.|::|.||::||..:.:||.:
Human     7 CLKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIAD 71

  Fly   101 GVVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDGK 165
            |.|||||:|.|||||:|||||:||:.||||:|...:|.|:||||||.||..|.|.:|.|||::||
Human    72 GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGK 136

  Fly   166 TLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATI--PPVTNQIECHPYLTQKK 228
            .::..||...||:||||..:.||.||||||||||||:|.:|....:  .||.||:|||||..:.|
Human   137 VIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSK 201

  Fly   229 LIDFCKSKDITITAYSPLGSP-NRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANI 292
            |:||||||||.:.|||.|||. ::.|.....||:||:..:..:|.|.|:||..|.:|||:||..:
Human   202 LLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVV 266

  Fly   293 VIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPLLNQYGHPHHPFEKDEY 350
            |:.||..:.||..|.|||:|:||.|:::.|:..:.|.......:...||::|: .|||
Human   267 VLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY-SDEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 146/282 (52%)
Tas 45..>248 CDD:223739 114/207 (55%)
AKR1C3NP_001240837.1 ARA1 9..305 CDD:223729 148/295 (50%)
Tas 17..297 CDD:223739 144/279 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.