DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and AAD15

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_014477.1 Gene:AAD15 / 853999 SGDID:S000005525 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:87 Identity:27/87 - (31%)
Similarity:38/87 - (43%) Gaps:17/87 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 EAKIKEIAAKKKKTPG-----QILIRYQVQRANIVIPKSVTKDRIE---SNFQVFDFELTPEEIE 320
            |.||.|..||..:..|     .|.|.|...:|..|.| ||...:||   .|.:....:|||:.|:
Yeast    49 EIKISEALAKVAEEHGTESVTAIAIAYVRSKAKNVFP-SVEGGKIEDLKENIKALSIDLTPDNIK 112

  Fly   321 IIESFECNGRLVPLLNQYGHPH 342
            .:|:      :||.  ..|.|:
Yeast   113 YLEN------VVPF--DIGFPN 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 19/59 (32%)
Tas 45..>248 CDD:223739
AAD15NP_014477.1 AKR_SF <1..115 CDD:412396 22/66 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.