DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and AAD10

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_012689.1 Gene:AAD10 / 853620 SGDID:S000003916 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:303 Identity:56/303 - (18%)
Similarity:98/303 - (32%) Gaps:115/303 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 REDLFITSKLWNTFHRPDLVKS---------------ALENTLSSLKLKYLDLYLIHWPMGYKEG 154
            |:.:.|.:|....:...|:.|.               ::.::|..|:..::|:..:||       
Yeast     7 RDQIVIATKFTTDYKGYDVGKGKSANFCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW------- 64

  Fly   155 CDLFPTDKDGKTLYSPVDYV----DTWKAMEKLVEEGLVKSIGVS-------------------- 195
                            .||:    :...::..||::|.|..:|||                    
Yeast    65 ----------------WDYMSSIEEVMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKT 113

  Fly   196 ---------NFNRRQIERVLEVATIPPVTNQ--IECHPY-------LTQKKLIDFCKSKDITITA 242
                     |...|..||     .|.|:...  :...|:       ...||.::..|.|      
Yeast   114 PFSIYQGKWNVLNRDFER-----DIIPMARHFGMALAPWDVMGGGRFQSKKAVEERKKK------ 167

  Fly   243 YSPLGSPNRPWAKAGDPVILEEAKIKEIAAKKKKTPG-----QILIRYQVQRANIVIP----KSV 298
                |...|.:....:...: |.||.|...|..:..|     .|.|.|...:|..|.|    :.:
Yeast   168 ----GEGLRTFFGTSEQTDM-EVKISEALLKVAEEHGTESVTAIAIAYVRSKAKHVFPLVGGRKI 227

  Fly   299 TKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPLLNQYGHP 341
              :.::.|.:....:||||:|:.:||      :||.  ..|.|
Yeast   228 --EHLKQNIEALSIKLTPEQIKYLES------IVPF--DVGFP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 46/276 (17%)
Tas 45..>248 CDD:223739 30/199 (15%)
AAD10NP_012689.1 AKR_SF <1..250 CDD:412396 50/283 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.