DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and ARA1

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_009707.3 Gene:ARA1 / 852446 SGDID:S000000353 Length:344 Species:Saccharomyces cerevisiae


Alignment Length:296 Identity:114/296 - (38%)
Similarity:175/296 - (59%) Gaps:26/296 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DGNEIPVIGLGTFNSPK--GQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKRE 106
            :|..||.:||||.|..:  .:..:|||.||.|||||||.|:.|:.|..||:.::..:::|.:|||
Yeast    29 NGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLEDGSIKRE 93

  Fly   107 DLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKE--------GCDLFPTDKD 163
            |||||:|:|....  |.|..:|..:|.:|.|:|:||.|.|||:.:::        |....|.|..
Yeast    94 DLFITTKVWPVLW--DEVDRSLNESLKALGLEYVDLLLQHWPLCFEKIKDPKGISGLVKTPVDDS 156

  Fly   164 GKTLY-SPVDYVDTWKAMEKLV---EEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYL 224
            |||:| :..||::|:|.:||:.   .:..|::||||||:...:||:::...:.|..||:|.||:|
Yeast   157 GKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLIKECRVKPTVNQVETHPHL 221

  Fly   225 TQKKLIDFCKSKDITITAYSPLGSPNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQR 289
            .|.:|..||...||.:||||||||...|..|.  |:      :|::|.|...|...:||.|.:::
Yeast   222 PQMELRKFCFMHDILLTAYSPLGSHGAPNLKI--PL------VKKLAEKYNVTGNDLLISYHIRQ 278

  Fly   290 ANIVIPKSVTKDRIESNFQVFDFELTPEEIEIIESF 325
            ..||||:|:...||.|:.:.  ..||.:|::.:..|
Yeast   279 GTIVIPRSLNPVRISSSIEF--ASLTKDELQELNDF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 111/285 (39%)
Tas 45..>248 CDD:223739 90/216 (42%)
ARA1NP_009707.3 AKR_AKR3C1 22..321 CDD:381345 114/296 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.