DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and AAD4

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_010038.1 Gene:AAD4 / 851354 SGDID:S000002402 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:334 Identity:73/334 - (21%)
Similarity:125/334 - (37%) Gaps:103/334 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LGTFNSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDE---VGDGVEAKIKEGVVKREDLFITSKL 114
            :|:.|  |.|..|.:....:||...||.|..||||:.   :|:.::::     ..|:.:.|.:|.
Yeast     1 MGSMN--KEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKSR-----KLRDQIVIATKF 58

  Fly   115 WNTFHRPDL--VKSA-------------LENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDG 164
            ...:.:.::  .|||             :.::|..|:..::|:..:||                 
Yeast    59 TGDYKKYEVGGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW----------------- 106

  Fly   165 KTLYSPVDYV----DTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPY-L 224
                  .||:    :...::..||::|.|..:|||:.....:......||....|      |: :
Yeast   107 ------WDYMSSIEEVMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKT------PFSI 159

  Fly   225 TQKKL----IDFCKSKDITITAYSPLGSPNRPW-----------------AKAGDPVIL------ 262
            .|.|.    .||  .:|| |......|....||                 .|.|:.:..      
Yeast   160 YQGKWNVLNRDF--ERDI-IPMARHFGMALAPWDVMGGGRFQSKKAMEERKKNGEGLRTVSGTSK 221

  Fly   263 ---EEAKIKEIAAKKKKTPG-----QILIRYQVQRANIVIP----KSVTKDRIESNFQVFDFELT 315
               :|.||.|..||..:..|     .|.|.|...:|..|.|    :.:  :.::.|.:....:||
Yeast   222 QTDKEVKISEALAKVAEEHGTESVTAIAIAYVRSKAKNVFPLVGGRKI--EHLKQNIEALSIKLT 284

  Fly   316 PEEIEIIES 324
            ||:||.:||
Yeast   285 PEQIEYLES 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 66/324 (20%)
Tas 45..>248 CDD:223739 46/221 (21%)
AAD4NP_010038.1 AKR_AKR9A3_9B1-4 1..292 CDD:381373 71/331 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345901
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.