DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and AKR1E2

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_011518017.1 Gene:AKR1E2 / 83592 HGNCID:23437 Length:341 Species:Homo sapiens


Alignment Length:310 Identity:161/310 - (51%)
Similarity:197/310 - (63%) Gaps:30/310 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKREDLFITSKLWNTFHRPD 122
            || |:||||||.||||||||.||||.|.||.|||.|:..|||||.|:||||||.:|||.|.|:..
Human    36 SP-GKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKS 99

  Fly   123 LVKSALENTLSSLKLKYLDLYLIHWPMGYKE-------GC-------------DLFPTDKDGKTL 167
            ||::|...:|.:|||.||||||||||||:|.       .|             || |.|:....:
Human   100 LVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDL-PLDESNMVI 163

  Fly   168 YSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATI--PPVTNQIECHPYLTQKKLI 230
            .|..|::|||:|||.||..||||:|||||||..|:||:|....:  .|:|||||||||||||.||
Human   164 PSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLI 228

  Fly   231 DFCKSKDITITAYSPLGSPNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANIVIP 295
            .||:|:|:::|||.|||..........:||      ||.||.:..|:|.|||||:|:||..||||
Human   229 SFCQSRDVSVTAYRPLGGSCEGVDLIDNPV------IKRIAKEHGKSPAQILIRFQIQRNVIVIP 287

  Fly   296 KSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPLLNQYGHPHHPF 345
            .|:|...|:.|.||||||||..:::.|.|...|.||........|..:||
Human   288 GSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 152/279 (54%)
Tas 45..>248 CDD:223739 120/211 (57%)
AKR1E2XP_011518017.1 ARA1 34..322 CDD:223729 156/293 (53%)
Tas 42..314 CDD:223739 148/278 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154944
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - LDO PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.