DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and XB5731323

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_031755921.1 Gene:XB5731323 / 548351 XenbaseID:XB-GENE-5731324 Length:284 Species:Xenopus tropicalis


Alignment Length:302 Identity:101/302 - (33%)
Similarity:160/302 - (52%) Gaps:30/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ARAPKVVCLDGNEIPVIGLGTFNSPKGQVTEAVKVAI-DAGYRHIDCAYVYQNEDEVGDGVEAKI 98
            ::.|.|....|..||::||| .:...|....|:..|: ..|.||||.|..|.||..||..    |
 Frog     4 SKIPTVPLASGQHIPLLGLG-MSHVGGYCHNALLYALTTCGIRHIDTAKRYGNEVMVGKA----I 63

  Fly    99 KEGVVKREDLFITSKLW-NTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDK 162
            .|..||||:|::|:||| ..:...:.:::.|: :...|.:.||||||:|||.....|    .:.:
 Frog    64 CESGVKREELWLTTKLWPGDYGYENAIQACLD-SCKRLGVDYLDLYLMHWPDAQIPG----KSAR 123

  Fly   163 DGKTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYLTQK 227
            :.:        .:||:|:|:|.|.|:.:|||||||....::::.|...:.|..||:|.||:...:
 Frog   124 EAR--------AETWQALEELNERGICRSIGVSNFLIHHLDQLKEDCNMVPHLNQVEYHPFQRPQ 180

  Fly   228 KLIDFCKSKDITITAYSPLGSPNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANI 292
            :|:|:|:..:|....|.||....          .|....|::||....|||.|:.||:.:|...:
 Frog   181 ELVDYCRRNNIVFEGYCPLAKGQ----------ALNHPVIQKIAKNYGKTPAQVCIRWSIQNGIV 235

  Fly   293 VIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPL 334
            .||||..::||:.|.:||:|:|..|.::.|.|...|.:|:.|
 Frog   236 TIPKSTKEERIQENCEVFNFQLEQEHMDCITSLNSNRKLIHL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 95/279 (34%)
Tas 45..>248 CDD:223739 71/204 (35%)
XB5731323XP_031755921.1 AKR_CeZK1290-like 5..268 CDD:381361 97/290 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.