DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and RGD1564865

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001157868.1 Gene:RGD1564865 / 498789 RGDID:1564865 Length:323 Species:Rattus norvegicus


Alignment Length:312 Identity:145/312 - (46%)
Similarity:211/312 - (67%) Gaps:8/312 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DGNEIPVIGLGTFNSPK---GQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKR 105
            ||..:|::|.|||.:|:   .::.|:.|:|||.|:||||.||||:||.|||:.:.:||..|||||
  Rat    12 DGRLMPLLGYGTFQNPEIPASKILESTKIAIDIGFRHIDSAYVYKNEKEVGEAIRSKITGGVVKR 76

  Fly   106 EDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDGKTLYSP 170
            ||:|:|:|||:|||||:||:..||.:|.|.:|.|:||||||:|:..|...:::..|::||.|:..
  Rat    77 EDIFLTTKLWSTFHRPELVRVGLERSLKSFQLDYVDLYLIHYPISIKPSEEIYTKDENGKILFET 141

  Fly   171 VDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIP--PVTNQIECHPYLTQKKLIDFC 233
            ||....|:||||..:.||.||||||||||||:|.:|....:.  ||.||:||||||.|.||:|||
  Rat   142 VDLCAIWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKHRPVCNQVECHPYLNQSKLMDFC 206

  Fly   234 KSKDITITAYSPLGSPNRP--WAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANIVIPK 296
            ||:||.:.||:.||| .||  |.....|.:|.:..:..:|.|..::|.||.:||||||..:.:.:
  Rat   207 KSQDIVLVAYAALGS-QRPTNWVDKNAPFLLNDPVLGGMAKKHNRSPAQIALRYQVQRGVVALAQ 270

  Fly   297 SVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPLLNQYGHPHHPFEKD 348
            :..:..::.|.|||:|:|..|::|:::....|.|..|:.....||::|:..|
  Rat   271 TYEQKEMKENIQVFEFQLPSEDMEVLDGLNRNFRYFPVNIAAEHPNYPYSDD 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 136/278 (49%)
Tas 45..>248 CDD:223739 111/207 (54%)
RGD1564865NP_001157868.1 ARA1 8..311 CDD:223729 141/299 (47%)
Tas 19..297 CDD:223739 135/278 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.