DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and AKR1B15

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001074007.2 Gene:AKR1B15 / 441282 HGNCID:37281 Length:344 Species:Homo sapiens


Alignment Length:291 Identity:168/291 - (57%)
Similarity:207/291 - (71%) Gaps:4/291 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKREDLFITSKLWNTFHRPDLVK 125
            |:|.|||||||||.||||||||.|:|:.|||:.::.||:|..|.||||||.||:|.||....||:
Human    54 GKVKEAVKVAIDAEYRHIDCAYFYENQHEVGEAIQEKIQEKAVMREDLFIVSKVWPTFFERPLVR 118

  Fly   126 SALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDGKTLYSPVDYVDTWKAMEKLVEEGLVK 190
            .|.|.||..|||.|||:||||||.|:|.|.|.||.|..|..:.....::|.|:|||:||:|||||
Human   119 KAFEKTLKDLKLSYLDVYLIHWPQGFKTGDDFFPKDDKGNMISGKGTFLDAWEAMEELVDEGLVK 183

  Fly   191 SIGVSNFNRRQIERVLEVATI--PPVTNQIECHPYLTQKKLIDFCKSKDITITAYSPLGSPNRPW 253
            ::||||||..||||:|....:  .|||||:||||||||:|||.:|.||.||:|||||||||:|||
Human   184 ALGVSNFNHFQIERLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPW 248

  Fly   254 AKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANIVIPKSVTKDRIESNFQVFDFELTPEE 318
            ||..||.:||:.||||||||.|||..|:|||:.:||...|||||:|...|..|.|||||:|:.||
Human   249 AKPEDPSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRNVTVIPKSMTPAHIVENIQVFDFKLSDEE 313

  Fly   319 IEIIESFECNGRLVPLLNQYGH-PHHPFEKD 348
            :..|.||..|.|... ..::.| ...||:.:
Human   314 MATILSFNRNWRAFD-FKEFSHLEDFPFDAE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 158/256 (62%)
Tas 45..>248 CDD:223739 115/188 (61%)
AKR1B15NP_001074007.2 ARA1 56..325 CDD:223729 163/268 (61%)
Tas 57..317 CDD:223739 158/259 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 357 1.000 Domainoid score I983
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 373 1.000 Inparanoid score I2118
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm41206
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.