DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and Akr1c19

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001013807.2 Gene:Akr1c19 / 432720 MGIID:2653678 Length:323 Species:Mus musculus


Alignment Length:318 Identity:158/318 - (49%)
Similarity:217/318 - (68%) Gaps:17/318 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DGNEIPVIGLGTF-------NSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEG 101
            |||.||.:|.||:       |.|    .||:.:|::||:||||.|||||.|:.||..:.:||..|
Mouse    12 DGNFIPALGFGTYKPEEVNENKP----LEAIHLALEAGFRHIDTAYVYQTENHVGQAIRSKIAAG 72

  Fly   102 VVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDGKT 166
            :|||||:|:|:|||.|||||:||:|.||.:|.:|:|.|.||||||:|:..|.|.||||.|:.|||
Mouse    73 LVKREDIFLTTKLWCTFHRPELVRSNLEKSLKNLQLDYADLYLIHYPVQMKPGEDLFPEDEHGKT 137

  Fly   167 LYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATI--PPVTNQIECHPYLTQKKL 229
            |:..||...||:||||..:.||||||||||||.||:|::|....:  .||.||:|||.||.|:||
Mouse   138 LFDTVDICATWEAMEKCKDAGLVKSIGVSNFNSRQLEKILNKPGLKYKPVCNQVECHLYLNQRKL 202

  Fly   230 IDFCKSKDITITAYSPLGSPNRP--WAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANI 292
            :::||||||.:.||..||| .||  |.....||:|.:..:.::|.|.|::|.||.:||.:||..:
Mouse   203 LNYCKSKDIVLVAYCALGS-QRPKRWVDPSSPVLLNDPILCDMAKKHKRSPAQIALRYHLQRGIV 266

  Fly   293 VIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPLLNQYGHPHHPFEKDEY 350
            |:.:|..::.|:.|.|||:|||..|:::|::|.:.|.|..|.....|||.:|| .||:
Mouse   267 VLAQSYKENEIKENIQVFEFELPSEDMKILDSLDRNLRYAPAPFGEGHPEYPF-SDEF 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 145/282 (51%)
Tas 45..>248 CDD:223739 116/211 (55%)
Akr1c19NP_001013807.2 ARA1 8..307 CDD:223729 150/299 (50%)
Tas 11..310 CDD:223739 151/302 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.