DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and CG18547

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster


Alignment Length:362 Identity:82/362 - (22%)
Similarity:139/362 - (38%) Gaps:104/362 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VFRITLRNYGKPERFMWCQKEYARAPKVVCLDGNEIPVIGLG--------TFNSPKG--QVTEAV 67
            |.|:..||.||                    .|.::..:..|        .|:..:|  .|.|||
  Fly    19 VRRMEYRNLGK--------------------TGLQVSKVSFGGGALCANYGFDLEEGIKTVHEAV 63

  Fly    68 KVAIDAGYRHIDCAYVY---QNEDEVGDGVEAKIKEGVVKREDLFITSKLWNTFHRPDL------ 123
            |    :|..:||.|..|   ::|:.:|    ..:|:  |.||..:|.:|:    .|.:|      
  Fly    64 K----SGINYIDTAPWYGQGRSEEVLG----LALKD--VPRESYYIATKV----ARYELDYDKMF 114

  Fly   124 ------VKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDL-FPTDKDGKTLYSPVDYVDTWKAME 181
                  .:.::|.:|..|.|.|:|:..||         |: |..|.|       :...:|...:|
  Fly   115 DFSAKKTRESVEKSLKLLGLDYVDVIQIH---------DIEFAKDLD-------IVINETLPTLE 163

  Fly   182 KLVEEGLVKSIGVS--------NFNRRQIERVLEVATIPPVTNQIECHPYLTQKKL---IDFCKS 235
            :||:||..:.||||        .|..|...|:..|.|....|        ||.:.|   :||.||
  Fly   164 QLVKEGKARFIGVSAYPISVLKEFLTRTAGRLDTVLTYARYT--------LTDETLLEYLDFFKS 220

  Fly   236 KDITI--TAYSPLG----SPNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQ---RAN 291
            :::.:  .|...||    :..:||..|.|.......|..|:..::....|::.:.|.:.   ..:
  Fly   221 QNLGVICAAAHALGLLTNAGPQPWHPASDEQKAIARKASEVCKERGVELGKLAMYYTMSGLPEVS 285

  Fly   292 IVIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECN 328
            ..:....|:..:..|....:..|:.:|.|::...:.|
  Fly   286 TFLTGMQTRQLLRINLDANEVGLSDKEQEVLRYLKEN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 73/323 (23%)
Tas 45..>248 CDD:223739 62/245 (25%)
CG18547NP_650138.1 Tas 22..331 CDD:223739 80/359 (22%)
Aldo_ket_red 24..321 CDD:294321 79/354 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.