DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and CG2767

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster


Alignment Length:321 Identity:135/321 - (42%)
Similarity:192/321 - (59%) Gaps:18/321 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DGNEIPVIGLGTFNSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKREDL 108
            :|.::||||:||:.:...::..|:..|::|||||||.|.||.||..:|..::..:..|.||||:|
  Fly    11 NGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREEL 75

  Fly   109 FITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCD-LFPTDKDGKTLYSPVD 172
            ||.:|:....:||..|:..::.:|..|:|.|:||||:|.|.......| .|..||:|   ...||
  Fly    76 FIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEG---LMEVD 137

  Fly   173 ----YVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYLTQKKLIDFC 233
                :...|.|||.|||:||.||||||||::.|:.|:|:...|.|..||||.|.||.|:.|:|||
  Fly   138 VTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVDFC 202

  Fly   234 KSKDITITAYSPLGSPNRPWAKAGD------PVILEEAKIKEIAAKKKKTPGQILIRYQVQRANI 292
            ||::||:||||||||.......||.      |.:::..::|||||...|||.|:|:|:.:.....
  Fly   203 KSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVS 267

  Fly   293 VIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPLLNQYG---HPHHPFEKDEY 350
            .||||....|::.|..|||||||.||:..:.|.:.|.|:......:|   ||...| |::|
  Fly   268 AIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTF-KNQY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 123/282 (44%)
Tas 45..>248 CDD:223739 95/207 (46%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 127/293 (43%)
Tas 10..297 CDD:223739 126/288 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I232
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I161
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
98.970

Return to query results.
Submit another query.