DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and CG10638

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster


Alignment Length:313 Identity:157/313 - (50%)
Similarity:200/313 - (63%) Gaps:7/313 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 APKVVCLDGNEIPVIGLGTFNSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEG 101
            ||.|...:|.|:|::||||:||...:...|||.|||.||||||.||.||||.|||..:..||.||
  Fly     4 APTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEG 68

  Fly   102 VVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCD--LFPTDKDG 164
            ||||||:|:.:||||.||.|:.|:......||:..|.|:||||:|.|:|||...|  |.|.::|.
  Fly    69 VVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDD 133

  Fly   165 KTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYLTQKKL 229
            ....|.|||:||:|||||||:.|||:||||||||..|:.|||....|.|||||:||.|.|.||.|
  Fly   134 VLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQKAL 198

  Fly   230 IDFCKSKDITITAYSPLGSPNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANIVI 294
            ..|||..|:|:|.|:|||.|.....|   |..:...::..||.|..||..||::||.|....|.|
  Fly   199 TAFCKKNDVTLTGYTPLGKPKPDIQK---PDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPI 260

  Fly   295 PKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVP--LLNQYGHPHHPF 345
            |||...:||..||.:||||||.||:.:::.:....|:||  |:....|.::||
  Fly   261 PKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 146/279 (52%)
Tas 45..>248 CDD:223739 116/204 (57%)
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 152/299 (51%)
Tas 5..297 CDD:223739 149/294 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468218
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm1169
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
1110.800

Return to query results.
Submit another query.