DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and Akr1c15

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001103370.1 Gene:Akr1c15 / 361267 RGDID:1307514 Length:324 Species:Rattus norvegicus


Alignment Length:324 Identity:161/324 - (49%)
Similarity:217/324 - (66%) Gaps:9/324 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EYARAPKVVCLDGNEIPVIGLGTFNS---PKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGV 94
            :::|:.|:  .|||.:||:|.|||.|   ||.:..||.|||||.|:||||.||.||||:|||..:
  Rat     4 KHSRSVKL--NDGNLMPVLGFGTFASKEIPKSKAAEATKVAIDVGFRHIDAAYFYQNEEEVGQAL 66

  Fly    95 EAKIKEGVVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFP 159
            ..|:.:|.|||||||.|:|:|.||.||:||:..||.:|..|.|.|:||.:||.|:..|.|.:|.|
  Rat    67 RDKMADGTVKREDLFYTTKIWITFLRPELVRQCLERSLKKLGLDYVDLCIIHIPIAMKPGEELLP 131

  Fly   160 TDKDGKTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATI--PPVTNQIECHP 222
            .|.:||.::..||..|||:|:||..:.||.|||||||||.:|:|.:|....:  .|..||:||||
  Rat   132 KDANGKFIFDTVDIRDTWEALEKCKDAGLSKSIGVSNFNHKQLELILNKPRLKYKPTCNQVECHP 196

  Fly   223 YLTQKKLIDFCKSKDITITAYSPLGS-PNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQ 286
            ||.|.||::|||||||.:.|||.||| .:..|..:..|.:||:..:..||.|..:||||:.:|||
  Rat   197 YLNQSKLLEFCKSKDIVLVAYSALGSHRDSSWVSSDSPYLLEDPVLMTIAKKHNQTPGQVALRYQ 261

  Fly   287 VQRANIVIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPLLNQYGHPHHPFEKDEY 350
            :||..:|:.||..:.||:.||||||||||||:::.|:|...|.|...:.....||.:|| .:||
  Rat   262 LQRGVVVLAKSFNEKRIKENFQVFDFELTPEDMKTIDSLNRNFRYSQMAFALDHPDYPF-LEEY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 147/283 (52%)
Tas 45..>248 CDD:223739 113/207 (55%)
Akr1c15NP_001103370.1 ARA1 9..306 CDD:223729 153/298 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.