DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and Gclm

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_059001.1 Gene:Gclm / 29739 RGDID:619871 Length:274 Species:Rattus norvegicus


Alignment Length:256 Identity:58/256 - (22%)
Similarity:105/256 - (41%) Gaps:69/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 DCAYVYQNE----------DEVGDGVEAKIKEGVVK-----REDLFITSKLWNT-FHRPDLVKSA 127
            ||.....||          .|..|.:|..:...|.|     ||::.:::||:.. .:.....::|
  Rat    45 DCIQKTLNEWSSQISPDLVREFPDVLECTMSHAVEKINPDEREEMKVSAKLFIVGSNSSSSTRNA 109

  Fly   128 LENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDGKTLYSPVDYVDT-WKAMEKLVEEGLVKS 191
            ::...|.|.:..||..::           ..|..:||..|  .::::.. |:.:|.||:...:.:
  Rat   110 VDMACSVLGVAQLDSVIM-----------ASPPIEDGVNL--SLEHLQPYWEELENLVQSKKIVA 161

  Fly   192 IGVSNFNRRQIERVLEVATIPPVTNQIE----C--HPYLTQKKLIDFCKSKDITITAYSPLGSPN 250
            ||.|:.::.|:|::.:.|.:.|.:||:.    |  .|.||.     |.|..||.:..::      
  Rat   162 IGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDLTA-----FAKQFDIQLLTHN------ 215

  Fly   251 RPWAKAGDP-VILEEAKIKEIAAKKKKTPG--------QILIRYQVQRANIVIPKSVTKDR 302
                   || .:|.||..:|  |.::..|.        ..|:||.|    ||..:.:.|.:
  Rat   216 -------DPKELLSEASFQE--ALQESIPDIEAQEWVPLWLLRYSV----IVKSRGIIKSK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 58/256 (23%)
Tas 45..>248 CDD:223739 43/191 (23%)
GclmNP_059001.1 AKR_SF <86..>211 CDD:412396 34/142 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.