DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and SPAP32A8.02

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_594178.1 Gene:SPAP32A8.02 / 2541584 PomBaseID:SPAP32A8.02 Length:283 Species:Schizosaccharomyces pombe


Alignment Length:296 Identity:103/296 - (34%)
Similarity:158/296 - (53%) Gaps:47/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VVCLDGNEIPVIGLGTF----NSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKE 100
            |...:|..||.||.|.|    |...|.||:    |:|:||||||.|.||.|||..|..:....::
pombe    11 VTLTNGMVIPRIGFGAFMLKYNECYGLVTQ----ALDSGYRHIDTAAVYGNEDICGKAIVDWCEK 71

  Fly   101 GVVKREDLFITSKLWN--TFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKD 163
            ..|||.|:|:||||.|  .::.   .::|:.::|..|. .|:||:||..|.|.|:          
pombe    72 NNVKRTDIFLTSKLANCSDYYS---TRAAIRSSLHHLG-TYIDLFLIQSPAGGKK---------- 122

  Fly   164 GKTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIP---PVTNQIECHPYLT 225
                    ..:.:|||||:.|:.|.::|:||||:..:.::.:  .|:.|   |..||||.||:|:
pombe   123 --------SRIASWKAMEEFVDSGDIRSVGVSNYGVKHLQEL--YASNPKFYPCVNQIELHPFLS 177

  Fly   226 QKKLIDFCKSKDITITAYSPLGSPNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRA 290
            |..::.:|:|.||.|.|||||....|          |.:.|:..||.|...:..|:|||:.:|:.
pombe   178 QDDIVKYCQSHDIAIEAYSPLTHGIR----------LNDEKLVPIAKKLNISVAQLLIRWSLQKG 232

  Fly   291 NIVIPKSVTKDRIESNFQVFDFELTPEEIEIIESFE 326
            .|.|.||..|:.:.|:..||:|.:..:.::.:.||:
pombe   233 YIPIIKSTKKEHMLSDLDVFNFTIPDDVVQELSSFD 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 101/284 (36%)
Tas 45..>248 CDD:223739 80/211 (38%)
SPAP32A8.02NP_594178.1 ARA1 6..283 CDD:223729 103/296 (35%)
Tas 16..279 CDD:223739 102/291 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.