DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and C56G3.2

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001367459.1 Gene:C56G3.2 / 183870 WormBaseID:WBGene00016985 Length:131 Species:Caenorhabditis elegans


Alignment Length:88 Identity:29/88 - (32%)
Similarity:47/88 - (53%) Gaps:10/88 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 WNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDGKTLYSPVDYVDTWKA 179
            |.....|..::.||.::|..|.|:|:||||.|.|..:        :|...:.:.|.|:  |.|:.
 Worm    53 WTNELAPGRLEGALRDSLKKLHLEYVDLYLAHMPTAF--------SDDMSQKIESSVE--DIWRQ 107

  Fly   180 MEKLVEEGLVKSIGVSNFNRRQI 202
            .:.:.:.||.|::||||:|..||
 Worm   108 FDAVYKAGLAKAVGVSNWNNDQI 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 29/88 (33%)
Tas 45..>248 CDD:223739 29/88 (33%)
C56G3.2NP_001367459.1 AKR_SF <51..>131 CDD:412396 29/88 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.