DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and C07D8.5

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_509243.1 Gene:C07D8.5 / 182366 WormBaseID:WBGene00015564 Length:134 Species:Caenorhabditis elegans


Alignment Length:94 Identity:40/94 - (42%)
Similarity:53/94 - (56%) Gaps:14/94 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DGNEIPVIGLGTFNSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKREDL 108
            :.:.:|.:||||:.|....|..|||.|:..||..||.|..|.||:.:|..::..|.|||||||||
 Worm    52 NAHSMPAVGLGTWQSNAEDVISAVKAAVKNGYSLIDTASGYNNEEFIGTAIKEVIAEGVVKREDL 116

  Fly   109 FITSKLWNTFHRPDLVKSALENTLSSLKL 137
            |||:|:.|.|              |||:|
 Worm   117 FITTKVPNLF--------------SSLRL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 40/94 (43%)
Tas 45..>248 CDD:223739 40/93 (43%)
C07D8.5NP_509243.1 AKR_SF 45..>126 CDD:382030 35/73 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.