DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and exc-15

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001367925.1 Gene:exc-15 / 178844 WormBaseID:WBGene00020369 Length:333 Species:Caenorhabditis elegans


Alignment Length:311 Identity:129/311 - (41%)
Similarity:193/311 - (62%) Gaps:12/311 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GNEIPVIGLGTFN-SPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKREDL 108
            |.::|:.||||:. ..:.::|.|::.|:|||||.||.|::||||..:|..:...|..|.:||||:
 Worm    11 GAQLPLFGLGTWQVKDEAELTVALRAALDAGYRLIDTAHLYQNEHIIGKVLHEYISSGKLKREDI 75

  Fly   109 FITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYK--EGCDLFPTDKDGKTLYSPV 171
            |:||||..|.|.|:.|...:|:.|.:|:|:|:||||||.|..:|  || ...|..::|:...:.:
 Worm    76 FVTSKLPFTAHAPEDVPKCVESQLKALQLEYIDLYLIHCPFPFKHQEG-SFAPLMENGELAVTEI 139

  Fly   172 DYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYLTQKKLIDFCKSK 236
            .::|||:|:|||.:||.:|::|||||:..|::.:.:.|.:.|...|:|||.|..|::|...||..
 Worm   140 AHIDTWRALEKLYKEGKLKALGVSNFSCNQLQALYDAAEVKPANQQVECHIYWPQQELRALCKKL 204

  Fly   237 DITITAYSPLGSPNRPWAK------AGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANIVIP 295
            .:|:|||:|||||.|..|:      .|||::  |..:|::|||..||..|||||:..|.....||
 Worm   205 GVTVTAYAPLGSPGRKAARPDGVWPEGDPLL--EPIVKQLAAKYHKTAAQILIRHLTQHGISTIP 267

  Fly   296 KSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPLLNQYGHPHHPFE 346
            |||:.|||..|...|||:|:.|::..:.|.|...||........||..|.:
 Worm   268 KSVSPDRIVENISTFDFKLSDEDMHTLNSIETRTRLFIADFAVKHPFFPHD 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 121/279 (43%)
Tas 45..>248 CDD:223739 87/205 (42%)
exc-15NP_001367925.1 AKR_AKR1G1_CeAKR 3..306 CDD:381380 126/297 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.