DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and AKR1C4

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001809.4 Gene:AKR1C4 / 1109 HGNCID:387 Length:323 Species:Homo sapiens


Alignment Length:313 Identity:149/313 - (47%)
Similarity:210/313 - (67%) Gaps:7/313 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DGNEIPVIGLGTF---NSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKR 105
            ||:.:||:|.||:   ..|:.:..|..|:||:||:||||.||:|.||::||..:.:||.:|.|||
Human    12 DGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVKR 76

  Fly   106 EDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDGKTLYSP 170
            ||:|.|||||.||.:|.:|:.|||::|..|:|.|:||||:|:||..|.|....|.|::||.::..
Human    77 EDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPLPKDENGKVIFDT 141

  Fly   171 VDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATI--PPVTNQIECHPYLTQKKLIDFC 233
            ||...||:.|||..:.||.|||||||||.||:|.:|....:  .||.||:||||||.|.||:|||
Human   142 VDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKPGLKYKPVCNQVECHPYLNQSKLLDFC 206

  Fly   234 KSKDITITAYSPLGSP-NRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRANIVIPKS 297
            |||||.:.|:|.||:. ::.|.....||:||:..:..:|.|.|:||..|.:|||:||..:|:.||
Human   207 KSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPVLCALAKKHKQTPALIALRYQLQRGVVVLAKS 271

  Fly   298 VTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPLLNQYGHPHHPFEKDEY 350
            ..:.||..|.|||:|:||.|::::::....|.|.|.:.....||.:|| .|||
Human   272 YNEQRIRENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPF-SDEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 137/277 (49%)
Tas 45..>248 CDD:223739 108/207 (52%)
AKR1C4NP_001809.4 AKR_AKR1C1-35 6..306 CDD:381334 141/293 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.