DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and LOC101733893

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_031746807.1 Gene:LOC101733893 / 101733893 -ID:- Length:290 Species:Xenopus tropicalis


Alignment Length:279 Identity:139/279 - (49%)
Similarity:187/279 - (67%) Gaps:6/279 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PKVVCLDGNEIPVIGLGTF---NSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIK 99
            |.|...||:::||:|.||:   ..||....|..|||||.||||||||::|.||.|||..::|||.
 Frog     7 PCVELNDGHKMPVLGFGTYAPEKFPKSLAEEGTKVAIDVGYRHIDCAFIYGNEVEVGRAIKAKIA 71

  Fly   100 EGVVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDG 164
            :|.|||||:|.|.|||:|||.|:.|:.|||.:|:.|:|.|:||::||.|:.:|.|.|..|.|::|
 Frog    72 DGTVKREDVFYTGKLWSTFHTPERVRPALEKSLTDLQLDYMDLFIIHNPVEFKPGDDPLPLDENG 136

  Fly   165 KTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATI--PPVTNQIECHPYLTQK 227
            |.::...|..|||||:||..:.|||:||||||||.:|:|.:|.:..:  .||.||:|||.||.|.
 Frog   137 KPIFHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHIYLDQS 201

  Fly   228 KLIDFCKSKDITITAYSPLGSPNRP-WAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQRAN 291
            ||::|||||||.:.||..|||.... |.....||:||...:..||.|..:||..:.:||.:||..
 Frog   202 KLLEFCKSKDIVLVAYGVLGSSREENWVDQSTPVLLENPILGAIAKKHNRTPAHVAMRYLLQRGV 266

  Fly   292 IVIPKSVTKDRIESNFQVF 310
            :|:.||.|..||:.||:||
 Frog   267 VVLAKSFTPARIKENFKVF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 139/279 (50%)
Tas 45..>248 CDD:223739 110/207 (53%)
LOC101733893XP_031746807.1 AKR_AKR1C1-35 7..286 CDD:381334 139/279 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.