DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1B and LOC100494522

DIOPT Version :9

Sequence 1:NP_001261716.1 Gene:Akr1B / 39304 FlyBaseID:FBgn0086254 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_031746808.1 Gene:LOC100494522 / 100494522 -ID:- Length:263 Species:Xenopus tropicalis


Alignment Length:251 Identity:125/251 - (49%)
Similarity:169/251 - (67%) Gaps:6/251 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DGNEIPVIGLGTF---NSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAKIKEGVVKR 105
            ||:::||:|.||:   ..||....|..|||||.||||||||::|.||.|||..::|||.:|.|||
 Frog    13 DGHKMPVLGFGTYAPEKFPKSLAEEGTKVAIDVGYRHIDCAFIYGNEVEVGRAIKAKIADGTVKR 77

  Fly   106 EDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYKEGCDLFPTDKDGKTLYSP 170
            ||:|.|.|||:|||.|:.|:.|||.:|:.|:|.|:||::||.|:.:|.|.|..|.|::||.::..
 Frog    78 EDVFYTGKLWSTFHTPERVRPALEKSLTDLQLDYMDLFIIHNPVEFKPGDDPLPLDENGKPIFHN 142

  Fly   171 VDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATI--PPVTNQIECHPYLTQKKLIDFC 233
            .|..|||||:||..:.|||:||||||||.:|:|.:|.:..:  .||.||:||..||.|.||::||
 Frog   143 TDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECPIYLDQSKLLEFC 207

  Fly   234 KSKDITITAYSPLGSPNRP-WAKAGDPVILEEAKIKEIAAKKKKTPGQILIRYQVQ 288
            |||||.:.||..|||.... |.....||:||...:..||.|..:||..:.:||.:|
 Frog   208 KSKDIVLVAYGVLGSSREENWVDQSTPVLLENPILGAIAKKHNRTPAHVAMRYLLQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1BNP_001261716.1 ARA1 38..316 CDD:223729 125/251 (50%)
Tas 45..>248 CDD:223739 109/207 (53%)
LOC100494522XP_031746808.1 AKR_SF 8..263 CDD:412396 124/249 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.