DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Duba and AT3G57810

DIOPT Version :10

Sequence 1:NP_648482.3 Gene:Duba / 39302 FlyBaseID:FBgn0036180 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_850716.1 Gene:AT3G57810 / 824950 AraportID:AT3G57810 Length:317 Species:Arabidopsis thaliana


Alignment Length:142 Identity:36/142 - (25%)
Similarity:58/142 - (40%) Gaps:24/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 YELKPVEEDGACLFRSISLQIYG--------------DEEMHDVIRQHTMDYIHENREYFGQFVT 266
            |.:..:..||.|||||::   :|              ..|:.|.:|....|...:.|:....||.
plant   168 YSIIGIPGDGRCLFRSVA---HGFCLRSGKLAPGEKMQRELADELRTRVADEFIQRRQETEWFVE 229

  Fly   267 EDINSYIQRKRARDAH--GNHIEIQAISEIYSRTVEVYCYQSNP---INIFNSEQSQAGYPPLRL 326
            .|.::|:  ::.||.|  |...|:...|.:....:.||......   |:|....|......|:|:
plant   230 GDFDTYV--RQIRDPHVWGGEPELFMASHVLQMPITVYMKDDKAGGLISIAEYGQEYGKDDPIRV 292

  Fly   327 SYQRGSHYNAIL 338
            .|....||:|:|
plant   293 LYHGFGHYDALL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DubaNP_648482.3 OTU_OTUD5-like 215..339 CDD:438589 36/142 (25%)
PTZ00449 <432..>634 CDD:185628
AT3G57810NP_850716.1 OTU_plant_OTU4-like 167..304 CDD:438597 35/140 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.