DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and MET31

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_015287.1 Gene:MET31 / 856069 SGDID:S000005959 Length:177 Species:Saccharomyces cerevisiae


Alignment Length:166 Identity:43/166 - (25%)
Similarity:64/166 - (38%) Gaps:55/166 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 IRLGTALDGSPLYMCPECHVAYPEPELLEVHLV-----------GHNLEKR----YVCDICQASL 365
            ||..:.|  |.:...||..:...|||.:...|:           |:|..|.    |.|..||...
Yeast    42 IRQSSPL--SAVIPAPENVLKAGEPENMARGLIRIPETQTKRTGGNNHSKEGAQLYSCAKCQLKF 104

  Fly   366 KRKDHLTRHKQSHNPERPYICTVCLKAFKRKEQLSLHFVIHSGEKRHQCGECGKGFYRKDHLRKH 430
            .|...|.||::.|:...|:||:                            .|||||.|||.|::|
Yeast   105 SRSSDLRRHEKVHSLVLPHICS----------------------------NCGKGFARKDALKRH 141

  Fly   431 TRSHIARRVKAELN--SHV--------RRENGTSML 456
            :.:...:|.:.:|:  |.|        ..:|||.:|
Yeast   142 SNTLTCQRNRKKLSEGSDVDVDELIKDAIKNGTGLL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 6/30 (20%)
COG5048 356..>412 CDD:227381 12/55 (22%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
zf-H2C2_2 370..395 CDD:290200 7/24 (29%)
C2H2 Zn finger 386..406 CDD:275368 1/19 (5%)
zf-H2C2_2 399..423 CDD:290200 5/23 (22%)
zf-C2H2 412..434 CDD:278523 10/21 (48%)
C2H2 Zn finger 414..434 CDD:275368 10/19 (53%)
MET31NP_015287.1 COG5048 <75..>166 CDD:227381 29/118 (25%)
C2H2 Zn finger 97..117 CDD:275368 7/19 (37%)
C2H2 Zn finger 125..144 CDD:275368 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.