Sequence 1: | NP_001036599.1 | Gene: | CG7368 / 39301 | FlyBaseID: | FBgn0036179 | Length: | 530 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_201474.1 | Gene: | IDD1 / 836806 | AraportID: | AT5G66730 | Length: | 500 | Species: | Arabidopsis thaliana |
Alignment Length: | 255 | Identity: | 52/255 - (20%) |
---|---|---|---|
Similarity: | 91/255 - (35%) | Gaps: | 97/255 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 283 TATTAGGSGATSGKKKKRKKRSKDRKTKLRPGEIRLGTALDGSPLYMCPECHVAYPEPELLEVHL 347
Fly 348 VGHNL--EKRYVCDICQASLKRKDHLTRHKQSHN-------------PERPYICTV--CL----- 390
Fly 391 ----------KAFKRK--------EQLSLHFVIHSGEKRHQ--CG------ECGKGFYRKDHL-- 427
Fly 428 -------------RKHTRSHIARRVKAELNSHVRRENGTSMLQPVVTEATTAALQHANQL 474 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7368 | NP_001036599.1 | C2H2 Zn finger | 330..350 | CDD:275368 | 3/19 (16%) |
COG5048 | 356..>412 | CDD:227381 | 21/93 (23%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 370..395 | CDD:290200 | 10/54 (19%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 9/44 (20%) | ||
zf-H2C2_2 | 399..423 | CDD:290200 | 9/31 (29%) | ||
zf-C2H2 | 412..434 | CDD:278523 | 10/44 (23%) | ||
C2H2 Zn finger | 414..434 | CDD:275368 | 9/40 (23%) | ||
IDD1 | NP_201474.1 | C2H2 Zn finger | 63..83 | CDD:275368 | 6/19 (32%) |
C2H2 Zn finger | 104..132 | CDD:275368 | 6/27 (22%) | ||
C2H2 Zn finger | 139..158 | CDD:275368 | 5/18 (28%) | ||
C2H2 Zn finger | 166..182 | CDD:275368 | 5/15 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 44 | 1.000 | Inparanoid score | I2683 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |