DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and NUC

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_199229.1 Gene:NUC / 834439 AraportID:AT5G44160 Length:466 Species:Arabidopsis thaliana


Alignment Length:279 Identity:57/279 - (20%)
Similarity:96/279 - (34%) Gaps:61/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 TTAGGSGATSGKKKKRKKRSKDRKTKLRPGEIRLGTALDGSPLYMCPECHVAYPEPELLEVHLVG 349
            |.:.|||....:........   ::.:.|..::....|.|:|   .||..|....|..|..    
plant     8 TISSGSGFAQPQSSSTLDHD---ESLINPPLVKKKRNLPGNP---DPEAEVIALSPTTLMA---- 62

  Fly   350 HNLEKRYVCDICQASLKRKDHLTRHKQSHN-------------PERPYIC--TVCL-----KAFK 394
               ..|::|::|....:|..:|..|::.||             .:|.|:|  ..|:     :|..
plant    63 ---TNRFLCEVCGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHSSRALG 124

  Fly   395 RKEQLSLHFVIHSGEKRHQCGECGKGFYRKDHLRKHTRSHIARRVKAELNSHVRRENG----TSM 455
            ....:..||....|||:..|.:|.|.:..:...:.|:::...|..:.:..:...|.:.    .:.
plant   125 DLTGIKKHFCRKHGEKKWTCEKCAKRYAVQSDWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAF 189

  Fly   456 LQPVVTE-ATTAALQHANQLASA----QQQLQQQQQQ-------QQQQQQQQQQQQQHH------ 502
            ...:..| |...|:.|.|.||:|    ...|..|...       |....|.|.....||      
plant   190 CDALAEETAKINAVSHLNGLAAAGAPGSVNLNYQYLMGTFIPPLQPFVPQPQTNPNHHHQHFQPP 254

  Fly   503 ------IVITQQQATPQQQ 515
                  :.:.|..|.||.|
plant   255 TSSSLSLWMGQDIAPPQPQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 5/19 (26%)
COG5048 356..>412 CDD:227381 17/75 (23%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
zf-H2C2_2 370..395 CDD:290200 9/44 (20%)
C2H2 Zn finger 386..406 CDD:275368 5/26 (19%)
zf-H2C2_2 399..423 CDD:290200 8/23 (35%)
zf-C2H2 412..434 CDD:278523 4/21 (19%)
C2H2 Zn finger 414..434 CDD:275368 4/19 (21%)
NUCNP_199229.1 C2H2 Zn finger 68..88 CDD:275368 5/19 (26%)
C2H2 Zn finger 109..137 CDD:275368 5/27 (19%)
C2H2 Zn finger 144..163 CDD:275368 4/18 (22%)
C2H2 Zn finger 171..187 CDD:275368 1/15 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.