DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and AT3G45260

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001327332.1 Gene:AT3G45260 / 823664 AraportID:AT3G45260 Length:446 Species:Arabidopsis thaliana


Alignment Length:258 Identity:55/258 - (21%)
Similarity:81/258 - (31%) Gaps:97/258 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 TSGKKKKRKKRSKDRKTKLRPGEIRLGTALDGSPLYMCPECHVAYPEPELLEVHLVGHNLEKRYV 357
            ||....|||:.                  |.|:|   .|:..|....|..|..       ..|::
plant    33 TSSNSAKRKRN------------------LPGNP---DPDAEVIALSPNSLMT-------TNRFI 69

  Fly   358 CDICQASLKRKDHLTRHKQSHN--------------PERPYIC--TVCL---------------K 391
            |::|....||..:|..|::.||              .::.|||  ..|:               |
plant    70 CEVCNKGFKRDQNLQLHRRGHNLPWKLKQRTNKEQVKKKVYICPEKTCVHHDPARALGDLTGIKK 134

  Fly   392 AFKRK--------EQLSLHFVIHSGEKRHQ--CG------ECGKGFYRKDHLRKHTRSHIARRVK 440
            .|.||        ::.|..:.:.|..|.|.  ||      :||..|.|||       |.|..|..
plant   135 HFSRKHGEKKWKCDKCSKKYAVMSDWKAHSKICGTKEYRCDCGTLFSRKD-------SFITHRAF 192

  Fly   441 AELNSHVRRENGTSMLQP----VVTEATTAALQHANQLASAQQQLQQQQQQQQQQQQQQQQQQ 499
            .:.   :..|:...:..|    .:..|....:.|.|        :.|..||:|......|..|
plant   193 CDA---LAEESARFVSVPPAPAYLNNALDVEVNHGN--------INQNHQQRQLNTTSSQLDQ 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 4/19 (21%)
COG5048 356..>412 CDD:227381 19/94 (20%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..395 CDD:290200 10/55 (18%)
C2H2 Zn finger 386..406 CDD:275368 7/44 (16%)
zf-H2C2_2 399..423 CDD:290200 9/31 (29%)
zf-C2H2 412..434 CDD:278523 9/29 (31%)
C2H2 Zn finger 414..434 CDD:275368 8/25 (32%)
AT3G45260NP_001327332.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.