Sequence 1: | NP_001036599.1 | Gene: | CG7368 / 39301 | FlyBaseID: | FBgn0036179 | Length: | 530 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001327332.1 | Gene: | AT3G45260 / 823664 | AraportID: | AT3G45260 | Length: | 446 | Species: | Arabidopsis thaliana |
Alignment Length: | 258 | Identity: | 55/258 - (21%) |
---|---|---|---|
Similarity: | 81/258 - (31%) | Gaps: | 97/258 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 293 TSGKKKKRKKRSKDRKTKLRPGEIRLGTALDGSPLYMCPECHVAYPEPELLEVHLVGHNLEKRYV 357
Fly 358 CDICQASLKRKDHLTRHKQSHN--------------PERPYIC--TVCL---------------K 391
Fly 392 AFKRK--------EQLSLHFVIHSGEKRHQ--CG------ECGKGFYRKDHLRKHTRSHIARRVK 440
Fly 441 AELNSHVRRENGTSMLQP----VVTEATTAALQHANQLASAQQQLQQQQQQQQQQQQQQQQQQ 499 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7368 | NP_001036599.1 | C2H2 Zn finger | 330..350 | CDD:275368 | 4/19 (21%) |
COG5048 | 356..>412 | CDD:227381 | 19/94 (20%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 370..395 | CDD:290200 | 10/55 (18%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 7/44 (16%) | ||
zf-H2C2_2 | 399..423 | CDD:290200 | 9/31 (29%) | ||
zf-C2H2 | 412..434 | CDD:278523 | 9/29 (31%) | ||
C2H2 Zn finger | 414..434 | CDD:275368 | 8/25 (32%) | ||
AT3G45260 | NP_001327332.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 44 | 1.000 | Inparanoid score | I2683 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |