DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and ZNF462

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_006717272.1 Gene:ZNF462 / 58499 HGNCID:21684 Length:2567 Species:Homo sapiens


Alignment Length:216 Identity:43/216 - (19%)
Similarity:79/216 - (36%) Gaps:38/216 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 RPGEIRLGTALDGSPLYMCPECHVAYPEPELLEVHLVGH------NLEKRYVCDICQASLKRKDH 370
            |||.            |.|.:|.......:.|..|...|      ..|.:|.|..|......:.:
Human  2048 RPGG------------YHCSQCDRVLMSMQGLRSHERSHLALAMFTREDKYSCQYCSFVSAFRHN 2100

  Fly   371 LTRHKQSHN-PERPYICTVCLKAFKRKEQLSLHFV-IHSGEKRHQCGECGKGFYRKDHLRKHTRS 433
            |.||.|:|: ..:|:.|.:|........:|..|.: .|:||..::|..|.........|::|:  
Human  2101 LDRHMQTHHGHHKPFRCKLCSFKSSYNSRLKTHILKAHAGEHAYKCSWCSFSTMTISQLKEHS-- 2163

  Fly   434 HIARRVKAELNSHVRRENGTSMLQPVVTEATTAALQHANQLASAQQQLQQQQQQQQQQQQQQQQQ 498
                     |..|.:   ..::.:|.:....::...|::|.|:..::::........:....|||
Human  2164 ---------LKVHGK---ALTLPRPRIVSLLSSHSHHSSQKATPAEEVEDSNDSSYSEPPDVQQQ 2216

  Fly   499 QQHHIVITQQQATPQQQQQTS 519
            ..|:    |..|..:...:.|
Human  2217 LNHY----QSAALARNNSRVS 2233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 4/19 (21%)
COG5048 356..>412 CDD:227381 16/57 (28%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..395 CDD:290200 8/25 (32%)
C2H2 Zn finger 386..406 CDD:275368 4/20 (20%)
zf-H2C2_2 399..423 CDD:290200 7/24 (29%)
zf-C2H2 412..434 CDD:278523 4/21 (19%)
C2H2 Zn finger 414..434 CDD:275368 4/19 (21%)
ZNF462XP_006717272.1 C2H2 Zn finger 2054..2074 CDD:275368 4/19 (21%)
C2H2 Zn finger 2088..2108 CDD:275368 6/19 (32%)
C2H2 Zn finger 2117..2138 CDD:275368 4/20 (20%)
zf-H2C2_5 2144..2169 CDD:316431 6/35 (17%)
C2H2 Zn finger 2146..2167 CDD:275368 5/31 (16%)
C2H2 Zn finger 2317..2337 CDD:275368
C2H2 Zn finger 2363..2383 CDD:275368
C2H2 Zn finger 2391..2412 CDD:275368
C2H2 Zn finger 2477..2497 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.