Sequence 1: | NP_001036599.1 | Gene: | CG7368 / 39301 | FlyBaseID: | FBgn0036179 | Length: | 530 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001296396.1 | Gene: | znf513a / 568216 | ZFINID: | ZDB-GENE-030131-9895 | Length: | 548 | Species: | Danio rerio |
Alignment Length: | 292 | Identity: | 75/292 - (25%) |
---|---|---|---|
Similarity: | 108/292 - (36%) | Gaps: | 66/292 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 186 TLTPGTTVADYLSHLPANTLPLS---LHH--FLKYSAETIKKENQQNVVLQVQTGPAIGI--NTL 243
Fly 244 GT-TTISIPQQAEQLTLQPQQQATLQVQTQAAVTATATTATATTAG-------GSGATSGKKKKR 300
Fly 301 KKRSKDRKTKLRPGEIRLGTALDGSPLYMCPECHVAYPEPELLEVHLVGHNLEKRYVCDICQASL 365
Fly 366 KRKDHLTRHKQSHNPERPYICTVC------LKAFKRKEQ----------------------LSLH 402
Fly 403 FVIHSGEKRHQCGECGKGFYRKDHLRKHTRSH 434 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7368 | NP_001036599.1 | C2H2 Zn finger | 330..350 | CDD:275368 | 5/19 (26%) |
COG5048 | 356..>412 | CDD:227381 | 22/83 (27%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 370..395 | CDD:290200 | 10/30 (33%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 7/47 (15%) | ||
zf-H2C2_2 | 399..423 | CDD:290200 | 11/23 (48%) | ||
zf-C2H2 | 412..434 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 414..434 | CDD:275368 | 6/19 (32%) | ||
znf513a | NP_001296396.1 | C2H2 Zn finger | 177..197 | CDD:275368 | |
zf-H2C2_2 | 189..214 | CDD:290200 | |||
COG5048 | 201..>503 | CDD:227381 | 68/270 (25%) | ||
C2H2 Zn finger | 205..225 | CDD:275368 | |||
zf-H2C2_2 | 217..242 | CDD:290200 | |||
C2H2 Zn finger | 233..253 | CDD:275368 | |||
C2H2 Zn finger | 391..411 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 403..428 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 431..454 | CDD:290200 | 9/22 (41%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 459..484 | CDD:290200 | 2/24 (8%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | 2/19 (11%) | ||
zf-H2C2_2 | 487..510 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 503..523 | CDD:275368 | 6/19 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24403 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |