Sequence 1: | NP_001036599.1 | Gene: | CG7368 / 39301 | FlyBaseID: | FBgn0036179 | Length: | 530 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001371404.1 | Gene: | ZNF407 / 55628 | HGNCID: | 19904 | Length: | 2248 | Species: | Homo sapiens |
Alignment Length: | 268 | Identity: | 60/268 - (22%) |
---|---|---|---|
Similarity: | 108/268 - (40%) | Gaps: | 73/268 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 295 GKKKKRK------KRSKDRKTKLRPGEIRLGTALDGSPLYMC--PECHVAYPEPELLEVHLVGHN 351
Fly 352 LEKRYVCDICQASLKRKDHLTRHKQSHNPERPYICTVCLKAFKRKEQLSLHFVIHSGEKRHQCGE 416
Fly 417 CGKGFYRK---DHLRK---HTRSH------------IARRVKAELNSHVRREN------------ 451
Fly 452 ---------------GTSMLQPVVTEA--TTAALQHANQLASAQQQLQQQQQQQQQQQQQQQQQQ 499
Fly 500 QHHIVITQ 507 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24403 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |