DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and pad

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster


Alignment Length:714 Identity:158/714 - (22%)
Similarity:228/714 - (31%) Gaps:222/714 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFTPFGNTFPGNIPGLPQFTTSTAPLVSTVTAAVTDVTVTGTNNPQQQQQQDAAG--------- 56
            :..||.|...|.: |..||...|           :...|||.|.||.|.|.|...|         
  Fly   191 IKITPLGKKEPIS-PAKPQQQHS-----------LQSQTVTPTINPTQLQLQPQLGDQLQPLWQQ 243

  Fly    57 -SSNRYQQQQQQVTHFGQATM--------TAGQGSSGN--------------------KFRGGQD 92
             ...:.|||.||:|:..|||.        |:..|.|..                    :|.|.|.
  Fly   244 IQQLQLQQQLQQLTNQLQATTQYSVAQDDTSSSGDSKKPKLNFVLSSPTAPQFTTSMPQFGGSQP 308

  Fly    93 -------------------------------DAIQGDKYNGHLVA-------------SSQQQ-- 111
                                           .::.|.:...:|::             :|.||  
  Fly   309 QIQLQLMPGSGGVTSAGTVPAQTQLNAAALLSSLAGPQSTTNLLSPNKCFLPITIRDENSDQQIV 373

  Fly   112 -------------QQQQQQQQTQYAT--------VAYASATATSAATDALQAGTSGQQQQQQQMQ 155
                         .|.|.:.|.|.||        :...|..||...|.. ..|..|...|...:.
  Fly   374 AHIDTKNLVLPTTYQVQMKLQPQLATADGQPIMQLTPTSIPATLQLTPQ-TLGNPGSAFQGTTVT 437

  Fly   156 QQQVTAPQELTQDLCNA--ILQQQVLQNTSWQTLTPGTTVADYLSHLPANTLPLSLHHFLKYSAE 218
            |.|..|||:....|.|.  :..||::::....|......:.:..:..|..|.|.|......:...
  Fly   438 QNQFLAPQQPLTQLPNTAQVTSQQIIRSPHTSTTNSQLVIRNVTNIPPTPTTPTSSKKAPTFKTP 502

  Fly   219 TIKKENQQNVVLQVQTGPAIGINTLGTTTISIPQQAEQLTLQPQ--QQATLQVQTQAAVTATATT 281
            :.|::...:...:...||:.| .:.||:|....:...|...|||  ||.|..:....|.|||:..
  Fly   503 SPKQKPMPSPKSKTTVGPSSG-GSNGTSTNEFKRLITQTKPQPQVKQQQTAGLSASGAPTATSAN 566

  Fly   282 ATATTAGGSGATSGKKKKR-----------------------------------KKRSKDRKTKL 311
            ..|.....|..|..|..|:                                   |.:||...|..
  Fly   567 QAAMQRLSSNTTITKVPKQPASLPAPAPTSNPAKLPMLNKQNITISRISMQTAPKAQSKPSTTSP 631

  Fly   312 RPGEIRLGTALDGSPLYMCP----------------------ECHVAYPEPELL-----EVHLVG 349
            .|....:..::........|                      :...|.|..::|     |.....
  Fly   632 TPASQPIPVSVPALSQAQPPPLAAQHKKIVRKPPENQDTSGQKVKAARPPQQILPSPQQEGQNAT 696

  Fly   350 HN-----LEKRYVCDICQASLKRKDHLTRHKQSHNPERPYICTV--CLKAFKRKEQLSLHFVIHS 407
            |:     .....:|..|:...|:|:|||:|.:.|...||:.|:.  |.|.|.|||.||.|.|.||
  Fly   697 HSGSEAPTTSGLICPTCKREFKKKEHLTQHVKLHAGLRPFKCSEEGCDKTFSRKEHLSRHLVSHS 761

  Fly   408 GEKRHQCGECGKGFYRKDHLRKHTRSHIARRVKA---------------------ELNSHVRREN 451
            |:|.:.|..|.|.|.|||:|.||.|.|.....:.                     |::..:|.|:
  Fly   762 GQKMYTCEVCKKPFSRKDNLNKHRRIHTQTSTETLYCCDVCNKNFATKLHYEKHREMHKKIRPES 826

  Fly   452 GTSMLQPVVTEATTA--ALQHANQLASAQQQLQ---QQQQQQQQQQQQQQQQQQHHIVITQQQA 510
            ..    |..|.:..|  ||.|.........:..   :|::..||.|.||...|..|:|.||..|
  Fly   827 AA----PGATASPAAAPALTHVRSNGQVPNKAVFEIKQERSAQQTQTQQPPAQVMHVVTTQDLA 886

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 5/46 (11%)
COG5048 356..>412 CDD:227381 26/57 (46%)
C2H2 Zn finger 358..378 CDD:275368 8/19 (42%)
zf-H2C2_2 370..395 CDD:290200 11/26 (42%)
C2H2 Zn finger 386..406 CDD:275368 11/21 (52%)
zf-H2C2_2 399..423 CDD:290200 12/23 (52%)
zf-C2H2 412..434 CDD:278523 11/21 (52%)
C2H2 Zn finger 414..434 CDD:275368 11/19 (58%)
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 8/19 (42%)
zf-C2H2 736..760 CDD:278523 11/23 (48%)
C2H2 Zn finger 738..760 CDD:275368 11/21 (52%)
zf-H2C2_2 752..777 CDD:290200 12/24 (50%)
zf-C2H2 766..788 CDD:278523 11/21 (52%)
C2H2 Zn finger 768..788 CDD:275368 11/19 (58%)
zf-H2C2_2 780..808 CDD:290200 5/27 (19%)
C2H2 Zn finger 799..819 CDD:275368 1/19 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.