DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and znf131

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_956799.2 Gene:znf131 / 393477 ZFINID:ZDB-GENE-040426-1563 Length:558 Species:Danio rerio


Alignment Length:275 Identity:54/275 - (19%)
Similarity:90/275 - (32%) Gaps:83/275 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 YMCPECHVAYPEPELLEVHLVGHNLE----------KRYVCDICQASLKRKDHLTRHKQSHNPER 382
            ::|..|..||.....|:.||..::.:          |.:||:.|:.......|...|.:.|..|:
Zfish   287 FVCRHCGKAYAREGALKQHLNNYHFDAEEQSRRQKKKVHVCEYCEKQFDHFGHFKEHLRKHTGEK 351

  Fly   383 P------------------------------------YICTVCLKAFKRKEQLSLHFVIHSGEKR 411
            |                                    |.|.||...|...||...|.|.|:|||.
Zfish   352 PFECPECHERFARNSTLKCHMSACQNGSGAKKGRKKLYECQVCSSVFNSWEQFKDHLVTHTGEKP 416

  Fly   412 HQCGECGKGFYRKDHLRKHTRSHIARRVK---AE---------------------LNSHVRRENG 452
            :.|..|...|.....|..|.:.|.:.:.|   ||                     |...:|.|:.
Zfish   417 NHCTLCDLWFTSPRDLHTHLQEHHSLQEKVIVAEDILISDPANVLSMEEGEERVILEDGIRVEHV 481

  Fly   453 TSMLQPVVTEATTAALQHANQLASAQQQ--------LQQQQQQQQQQQQQQQQQQQHHIVITQQQ 509
            |.....||....|..::...|:..:|.:        ||...::.::|....|.:::     |..:
Zfish   482 TVEPVDVVAVEETLVVEEETQIQPSQPEGGVAETVVLQVDSEKLKEQVMGIQVERE-----TVAE 541

  Fly   510 ATPQQQQQTSQQQQQ 524
            ....:|:..|.::.:
Zfish   542 PAEAKQEPASCEKTE 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
COG5048 356..>412 CDD:227381 21/91 (23%)
C2H2 Zn finger 358..378 CDD:275368 4/19 (21%)
zf-H2C2_2 370..395 CDD:290200 10/60 (17%)
C2H2 Zn finger 386..406 CDD:275368 8/19 (42%)
zf-H2C2_2 399..423 CDD:290200 9/23 (39%)
zf-C2H2 412..434 CDD:278523 5/21 (24%)
C2H2 Zn finger 414..434 CDD:275368 5/19 (26%)
znf131NP_956799.2 BTB 24..120 CDD:306997
zf-C2H2 257..279 CDD:306579
C2H2 Zn finger 259..279 CDD:275368
C2H2 Zn finger 289..347 CDD:275368 13/57 (23%)
COG5048 <310..441 CDD:227381 28/130 (22%)
C2H2 Zn finger 327..344 CDD:275368 3/16 (19%)
zf-H2C2_2 339..364 CDD:316026 5/24 (21%)
C2H2 Zn finger 355..372 CDD:275368 0/16 (0%)
C2H2 Zn finger 419..439 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.