DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and CG4707

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_611944.1 Gene:CG4707 / 37935 FlyBaseID:FBgn0035036 Length:673 Species:Drosophila melanogaster


Alignment Length:241 Identity:51/241 - (21%)
Similarity:88/241 - (36%) Gaps:66/241 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 YMCPECHVAYPEPELLEVHL-VGHNLEKRYVCDICQASLKRKDHLTRHKQSHNPERP-------- 383
            |.||||:...|....|:.|| ..|:.|...:||.|..:|:.:.:|.:|.:..:.|:|        
  Fly   456 YSCPECNKKIPTERKLKEHLRYMHDPEAAIICDKCGKTLRSQTNLKKHHELEHSEKPRPKPDPVQ 520

  Fly   384 ----------------------------YICTVCLKAFKRKEQLSLH-FVIHSGEKRHQCGECGK 419
                                        :.|.:|.|.......|..| :..|..|::.:||.|.|
  Fly   521 CEICGTWLRHLSGLKQHMKTVHEPPGDEHRCHICNKTSTNSRALKRHIYHNHLCERKFKCGMCEK 585

  Fly   420 GFYRKDHLRKHTRSHIARRVKAELNSHVRRENGTSMLQPVVTEATTAALQHANQLASAQQQLQQQ 484
            .|.|...||:||.:|....:....|.            |:...:.....:|..:|..|:.:..::
  Fly   586 AFKRPQDLREHTSTHTGEVLYTCPNC------------PMTFFSNANMYKHRQRLHRAEWEADRK 638

  Fly   485 QQQQQQQQQQQQQQQQHHIVITQQQATPQQQQQTS-----QQQQQQ 525
            :.......:           |:|...|..:::|||     |.:|:|
  Fly   639 KPLPPNIMK-----------ISQGATTAMKKRQTSGALFPQSEQKQ 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 8/20 (40%)
COG5048 356..>412 CDD:227381 15/92 (16%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..395 CDD:290200 7/60 (12%)
C2H2 Zn finger 386..406 CDD:275368 5/20 (25%)
zf-H2C2_2 399..423 CDD:290200 9/24 (38%)
zf-C2H2 412..434 CDD:278523 10/21 (48%)
C2H2 Zn finger 414..434 CDD:275368 10/19 (53%)
CG4707NP_611944.1 zf-AD 3..73 CDD:285071
C2H2 Zn finger 334..355 CDD:275368
LIM <361..407 CDD:295319
C2H2 Zn finger 365..382 CDD:275368
C2H2 Zn finger 390..410 CDD:275368
C2H2 Zn finger 427..443 CDD:275368
C2H2 Zn finger 458..476 CDD:275368 7/17 (41%)
C2H2 Zn finger 487..507 CDD:275368 6/19 (32%)
C2H2 Zn finger 521..540 CDD:275368 0/18 (0%)
C2H2 Zn finger 551..572 CDD:275368 5/20 (25%)
C2H2 Zn finger 580..600 CDD:275368 10/19 (53%)
C2H2 Zn finger 608..629 CDD:275368 3/32 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.