DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and CG30020

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster


Alignment Length:474 Identity:108/474 - (22%)
Similarity:167/474 - (35%) Gaps:118/474 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TTSTAPLVSTVTAAVTDVTVTGTNNPQQQQQQDAAGSSNRYQQQQQQVTHFGQATMTAGQGSSGN 85
            ||:.|...||::..|..|||.|.:|...|                   |..|...||...|:...
  Fly   900 TTTMATSSSTISEPVNSVTVDGQHNEMMQ-------------------TDVGAEKMTEALGNGDG 945

  Fly    86 KFRGGQDDAIQGDKYNGHLVASSQQQQQQQQQQQTQYATVAYASATATSAATDALQAGTSGQQQQ 150
            ...||.||        |..|.:.....:::....|..|..| .:.||.:||..|..|.|:     
  Fly   946 NEEGGTDD--------GTGVKAEPAVPEEELDPVTLDAATA-VTTTAIAAAISAAAAATA----- 996

  Fly   151 QQQMQQQQVTAPQELTQDLCNAILQQQVLQNTSWQTLTPGTTVADY---LSHLPANTLPLSLHHF 212
                  ..:.:|...|.              :|..||.|..|..|:   :....|.....::|..
  Fly   997 ------TSLESPVATTA--------------SSSTTLFPTPTPFDFDYDIMRDEAQQSSPNIHDV 1041

  Fly   213 LKYSAETIKKE---NQQNVVLQ---VQTGPAIGINT---LGTTTISI----PQQAEQLTLQPQQQ 264
            .|..::.....   |:...:|.   ::|.||.|:.:   |..::|.|    .|..::|....:.:
  Fly  1042 SKALSDNASSSCPINESYKLLSTTALETSPAKGLRSNSRLHRSSIHICKLCNQTFDELGKLVKHE 1106

  Fly   265 ATLQVQTQ---------AAVTATATTATATTAGGSGATSGKKKKRKKRSKDRKTKLRPGEIRLGT 320
            ..|...|:         .|:..|           |..|....|...||..:||::.:        
  Fly  1107 MELHSNTERSRWGYQHKCAICNT-----------SYRTLTLLKFHMKRHSNRKSQCK-------- 1152

  Fly   321 ALDGSPLYMCPECHVAYPEPELLEVHL-VGHNLEKRYVC--DICQASLKRKDHLTRHKQSHNPER 382
                    :||:..|...|   ||.|. ..|:.:|...|  |.|:.:...|.||.||:::.:...
  Fly  1153 --------LCPKSFVTIAE---LERHTKAKHSKDKTLRCFMDGCRKTFAFKHHLIRHQKASHLST 1206

  Fly   383 PYICTVCLKAFKRKEQLSLHFVIHSGEKRHQCGECGKGFYRKDHLRKHTR-SHIARRVKAELN-- 444
            .|||.||.|..|....|..|..:|.||..::|.:|.:.:.|:..|..|.. .|..|....||.  
  Fly  1207 RYICPVCNKEEKSNVHLKNHMSVHKGEITYKCPKCDRSYLRRGRLVTHALIIHDLRFTTEELGNL 1271

  Fly   445 ----SHVRRENGTSMLQPV 459
                ::..|.|...:..||
  Fly  1272 SSLATNQARPNDLKVATPV 1290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 7/20 (35%)
COG5048 356..>412 CDD:227381 20/57 (35%)
C2H2 Zn finger 358..378 CDD:275368 8/21 (38%)
zf-H2C2_2 370..395 CDD:290200 10/24 (42%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
zf-H2C2_2 399..423 CDD:290200 7/23 (30%)
zf-C2H2 412..434 CDD:278523 5/22 (23%)
C2H2 Zn finger 414..434 CDD:275368 5/20 (25%)
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368
C2H2 Zn finger 758..777 CDD:275368
C2H2 Zn finger 1089..1110 CDD:275368 2/20 (10%)
C2H2 Zn finger 1124..1144 CDD:275368 6/30 (20%)
C2H2 Zn finger 1151..1172 CDD:275368 7/39 (18%)
C2H2 Zn finger 1180..1203 CDD:275368 8/22 (36%)
C2H2 Zn finger 1210..1230 CDD:275368 7/19 (37%)
C2H2 Zn finger 1238..1254 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.