DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and kmg

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_609604.1 Gene:kmg / 34706 FlyBaseID:FBgn0032473 Length:747 Species:Drosophila melanogaster


Alignment Length:473 Identity:90/473 - (19%)
Similarity:161/473 - (34%) Gaps:103/473 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 AIQGDKYNGHLVASSQQQQQ-------QQQQQQTQYATVAYASATATSAATDALQAGTSGQQQQQ 151
            :|:|..  |.::..||..|.       :||.:|.:.....:..:.|...:.|:...|...::..:
  Fly    29 SIEGGA--GAVLPMSQSVQPLIGQDFLEQQLEQYKANNFMFPLSMAGFVSADSAPPGDLAKENME 91

  Fly   152 QQMQQQQVTAPQELTQDLCNAILQQQVLQNTS-----WQTLTPGTTVADYLSHL--------PAN 203
            ..:....   |.....|  :.:.|.::.:|.|     :.|..|    ..:||||        ..|
  Fly    92 NSLPDGN---PCNNNND--DELPQCKIRRNYSCNQCAFFTQNP----RSHLSHLRDVHGERIVIN 147

  Fly   204 TLPLSLH---HFLK------------------------------YSAETIKKENQQNVVLQVQTG 235
            ...|.|:   ||.|                              .|.|..|:..::::..|..||
  Fly   148 ECKLCLYASRHFQKLVRHMKMVHGCSDDGGAVQGSGAQPRGKRNLSREVRKRRLEESIEGQGATG 212

  Fly   236 PAIGINT---------LGTTTISIPQQAEQLTLQPQ----QQATLQ----VQTQAAVTATATTAT 283
            ..:.::.         |....:.:.||..||....|    ||..||    |::...:.:.|....
  Fly   213 QCLDLSVLRMIQNGPPLEQLKVELQQQEMQLLASVQAYNRQQEMLQLQQIVESHDNIFSMAYEFQ 277

  Fly   284 ATTAGGSGATSGKKKKRKKRSKDRKTKLRPG-EIRLGTALDGSPLYMCPECHVAYPEPELLEVHL 347
            ........|.|.|.:::...|...:|...|. :.|  ..:.|...:.|.:|..:.|.....:.|:
  Fly   278 TKLMPPKQAESLKLEQQNSSSDSEETAKSPSPDTR--ELVSGKEQFQCQKCSYSTPIRARFKKHV 340

  Fly   348 VGHNLEKRYVCDICQASLKRKDHLTRHKQSHNPERPYICTVCLKAFKRKEQLSLHFVIHSGEKR- 411
            ..|:: ....|..|......|.:|.||.::|.....:.|:.|..:...|:.|::|...|..... 
  Fly   341 KYHSM-PLIKCSSCDFHTPYKWNLDRHTKNHGANGHFKCSCCDFSTDIKQSLTIHESNHHVPMPV 404

  Fly   412 HQCGECGK-----------GFYRKDHLRKHTRSHIAR------RVKAELNSHVRRENGTSMLQPV 459
            ||.|...:           ...||....|:..:.:|.      |....:.||.::..|.:|....
  Fly   405 HQMGNRSRDEAEDLVDQQSSGSRKPETFKNGGATVASTESLLPRTSGIVCSHCQKRVGNAMQLIN 469

  Fly   460 VTEATTAALQHANQLASA 477
            ..:..|.||.:..||.::
  Fly   470 HLQVCTLALHNTTQLQAS 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 4/19 (21%)
COG5048 356..>412 CDD:227381 13/56 (23%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..395 CDD:290200 6/24 (25%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)
zf-H2C2_2 399..423 CDD:290200 6/35 (17%)
zf-C2H2 412..434 CDD:278523 6/32 (19%)
C2H2 Zn finger 414..434 CDD:275368 4/30 (13%)
kmgNP_609604.1 C2H2 Zn finger 540..560 CDD:275370
C2H2 Zn finger 568..586 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.