DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and odd

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster


Alignment Length:407 Identity:101/407 - (24%)
Similarity:147/407 - (36%) Gaps:136/407 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 DDAIQGDKYNGHLVASSQQQQQQQQQQQTQYATVAYASATATSAATDALQAGTSGQQQQQQQMQQ 156
            ::|:....:..|:....|||||||||||.:                  |......||||.|..||
  Fly    66 EEAVATQLHMRHMAHYQQQQQQQQQQQQHR------------------LWLQMQQQQQQHQAPQQ 112

  Fly   157 QQV--TA---PQELTQDLCN------AILQQQVLQNTSWQTLTPGTTVADYLSH-----LPANTL 205
            ..|  ||   |..:.|.|.|      ||.|||..|.             .:..|     .|.:..
  Fly   113 YPVYPTASADPVAVHQQLMNHWIRNAAIYQQQQQQQ-------------QHPHHHHHHGHPHHPH 164

  Fly   206 PLSLHHFLKYSAETIKKENQQNVVLQVQTGPAIGINTLGTTTISIPQQAEQLTLQPQQQATLQVQ 270
            | ..||...|.|                     |:::|                           
  Fly   165 P-HPHHVRPYPA---------------------GLHSL--------------------------- 180

  Fly   271 TQAAVTATATTATAT-TAGGSGATSGKKKKRKKRSKDRKTKLRPGEIRLGTALDGSPLYMCPECH 334
             .|||......|..| ..||:|..||........|:.:|.                  ::|..|:
  Fly   181 -HAAVMGRHFGAMPTLKLGGAGGASGVPSGATGSSRPKKQ------------------FICKYCN 226

  Fly   335 VAYPEPELLEVHLVGHNLEKRYVCDICQASLKRKDHLTRHKQSHNPERPYICTVCLKAFKRKEQL 399
            ..:.:...|.:|...|..|:.|.||||..:.:|:|||..|:..|:.::|:.|:.|.|.|.:...|
  Fly   227 RQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTL 291

  Fly   400 SLHFVIHSGEKRHQCGECGKGFYRKDHLRKHTRSHIARRVKAELNSHVRRENGTSMLQPVVTEAT 464
            ::|.|.|..|..|:|..|.:.|.::.:|:.|.:||..:..|                :.|||  |
  Fly   292 AVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSHSEQSTK----------------EVVVT--T 338

  Fly   465 TAALQHA--NQLASAQQ 479
            :.|..|:  ||..|:.|
  Fly   339 SPATSHSVPNQALSSPQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 4/19 (21%)
COG5048 356..>412 CDD:227381 21/55 (38%)
C2H2 Zn finger 358..378 CDD:275368 9/19 (47%)
zf-H2C2_2 370..395 CDD:290200 9/24 (38%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
zf-H2C2_2 399..423 CDD:290200 9/23 (39%)
zf-C2H2 412..434 CDD:278523 6/21 (29%)
C2H2 Zn finger 414..434 CDD:275368 5/19 (26%)
oddNP_722922.1 COG5048 <203..334 CDD:227381 40/164 (24%)
C2H2 Zn finger 222..242 CDD:275368 4/19 (21%)
zf-H2C2_2 234..259 CDD:290200 9/24 (38%)
C2H2 Zn finger 250..270 CDD:275368 9/19 (47%)
zf-H2C2_2 262..285 CDD:290200 8/22 (36%)
C2H2 Zn finger 278..298 CDD:275368 7/19 (37%)
zf-C2H2 304..326 CDD:278523 6/21 (29%)
C2H2 Zn finger 306..326 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.