DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and CG32772

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster


Alignment Length:544 Identity:120/544 - (22%)
Similarity:184/544 - (33%) Gaps:192/544 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VASSQQQQQQQQQQQTQYATVAYASATATSAATDALQAGTS------------GQQQQQQQMQQQ 157
            |..|:|........|:..|..|.|::.:.:.|..|..|.||            .||||.|..|||
  Fly    26 VRCSEQLTNNSNFHQSAAAAAAVAASASAAVAASAAAAATSSSTASSSDSDAIAQQQQHQNPQQQ 90

  Fly   158 QVTAPQELTQDLCNAILQQQVLQNTSWQTLTPGTTVADYLSHLPANTLPLSLHHFLKYSAETIKK 222
            |....|:..|       |||.:|::|                                |:|.::.
  Fly    91 QHQNSQQQQQ-------QQQQMQSSS--------------------------------SSENLQS 116

  Fly   223 ENQQNVVLQVQTGPAIGINTLGTTTISIPQQAEQLTLQPQQQATLQVQTQAAVTATATTATATTA 287
            ::....|..:       .|..|:..:.      ..|...:......::..:|......|..    
  Fly   117 QDDSEDVDLI-------FNEEGSCPLC------NKTFSRKSSLMTHIRNHSAERKFVCTYC---- 164

  Fly   288 GGSGATSGKKKKRKKR--SKDRK-------------TKLRPGEIRLGTALDGSPLYMC--PECHV 335
             ..|.|.....:..:|  :.||.             |.|. ...||.|   |...::|  |||..
  Fly   165 -HKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLN-NHRRLHT---GERPFVCNEPECGR 224

  Fly   336 AYPEPELLEVHLVGHNLEKRYVCDICQASLKRKDHLTRHKQSHN----------PER-------- 382
            ::.:...|..|:..|:..::|.|::|.....:...|.:|.|:|.          ||:        
  Fly   225 SFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQL 289

  Fly   383 -----------PYICTVCLKAFKRKEQLSLHFVIHSGEKRHQCGECGKGFYRKDHLRKHTRSHIA 436
                       ||.|..|.:.|.::..|..|..:|. |.:.:|..|...|.::..|:||.:.|:.
  Fly   290 HTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMHD-EFKFKCDICPSSFNQESLLKKHVQRHVE 353

  Fly   437 RR--------------VKAELNSHV--------------RRENGT--SMLQPVV----------- 460
            .|              |:..|:.|:              .::.||  :..||:.           
  Fly   354 GRYLSCPVANCAESFAVRQHLSKHLLTNHAHHELPPPKRSKKAGTLQTSQQPLAMIGQPLSLQHT 418

  Fly   461 -----------TEATTAAL-------------QHANQLA--SAQQQLQQQQQQQQQQQQQQQQQQ 499
                       .:|||.|.             ||.:.::  |.|||:.|..|||..|||.|||..
  Fly   419 TGQRGRPPKNKNKATTLAATAIKIEINESLHSQHISNVSGLSIQQQINQHMQQQAAQQQAQQQAA 483

  Fly   500 QHHIVITQQQATPQQQQQTSQQQQ 523
            |.     |||...|||||.:||||
  Fly   484 QQ-----QQQQAAQQQQQAAQQQQ 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 6/21 (29%)
COG5048 356..>412 CDD:227381 18/84 (21%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
zf-H2C2_2 370..395 CDD:290200 11/53 (21%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)
zf-H2C2_2 399..423 CDD:290200 7/23 (30%)
zf-C2H2 412..434 CDD:278523 6/21 (29%)
C2H2 Zn finger 414..434 CDD:275368 6/19 (32%)
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 51/276 (18%)
C2H2 Zn finger 133..153 CDD:275368 1/25 (4%)
zf-H2C2_2 145..170 CDD:290200 3/29 (10%)
C2H2 Zn finger 161..181 CDD:275368 4/24 (17%)
zf-H2C2_2 173..198 CDD:290200 3/24 (13%)
C2H2 Zn finger 189..209 CDD:275368 3/20 (15%)
C2H2 Zn finger 217..239 CDD:275368 6/21 (29%)
zf-H2C2_2 231..256 CDD:290200 6/24 (25%)
C2H2 Zn finger 247..267 CDD:275368 5/19 (26%)
C2H2 Zn finger 275..296 CDD:275368 2/20 (10%)
C2H2 Zn finger 304..324 CDD:275368 5/19 (26%)
C2H2 Zn finger 331..351 CDD:275368 6/19 (32%)
C2H2 Zn finger 359..380 CDD:275368 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.