DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and row-1

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001122473.1 Gene:row-1 / 172928 WormBaseID:WBGene00009508 Length:584 Species:Caenorhabditis elegans


Alignment Length:226 Identity:52/226 - (23%)
Similarity:85/226 - (37%) Gaps:51/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 KKRSKDR---KTKLR---PGEIRLGTALDGSPLYMCPECHVAYPEPELLEVHLVGHNLEKRYV-- 357
            ||.|||.   ...||   ..::...:||....|..|..|:..:....|..:|:|..::|:.::  
 Worm   209 KKESKDDGMFSCLLRNSDAAQLAENSALSLKRLQTCQFCNAVFRTVHLKTIHVVKCHMEQDHLDT 273

  Fly   358 -CDICQASLKRKDHLTRHKQSH-NPERPYICTVC-----LKAFKRKEQLSLHFV-IHSGEKRH-Q 413
             |:||:........|..|.:.| :.|.||.|..|     ::||     ...||: .||.:.|. .
 Worm   274 TCNICELDFGNSIALNTHMKKHISGEAPYNCQKCKYRTSVRAF-----FYQHFIEKHSNDSRTLL 333

  Fly   414 CGEC------------GKGFYRKD---HLRKHT-----RSHI-ARRVKAELNSHVRRENGTSMLQ 457
            |..|            .|..:.::   |:|.|.     |.|: |....:.|.....|.|..:||.
 Worm   334 CPICLHHEDLRPNVRRSKHIFVREFVNHMRSHALGPQMRCHVCALTFTSRLLLEAHRTNDHTMLN 398

  Fly   458 PV--------VTEATTAALQHANQLASAQQQ 480
            .:        |.|.....:...|::...|::
 Worm   399 SLWQVIERKSVHETEREHMSKRNKIGLLQRR 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 5/19 (26%)
COG5048 356..>412 CDD:227381 17/65 (26%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
zf-H2C2_2 370..395 CDD:290200 10/30 (33%)
C2H2 Zn finger 386..406 CDD:275368 6/25 (24%)
zf-H2C2_2 399..423 CDD:290200 8/37 (22%)
zf-C2H2 412..434 CDD:278523 7/42 (17%)
C2H2 Zn finger 414..434 CDD:275368 7/39 (18%)
row-1NP_001122473.1 GAT1 <15..288 CDD:227928 19/78 (24%)
C2H2 Zn finger 244..265 CDD:275368 5/20 (25%)
C2H2 Zn finger 275..295 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.