DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7368 and ZNF513

DIOPT Version :9

Sequence 1:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_653232.3 Gene:ZNF513 / 130557 HGNCID:26498 Length:541 Species:Homo sapiens


Alignment Length:146 Identity:44/146 - (30%)
Similarity:61/146 - (41%) Gaps:24/146 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 KLRPGE-IRLGTAL-------------DGSPL------YMCPECHVAYPEPELLEVHLVGHNLEK 354
            :|..|| .|||.|:             .|.|.      :.|..|..|...|..|..|:..|:.||
Human   322 ELEEGEGSRLGAAMCGRCMRGEAGGGASGGPQGPSDKGFACSLCPFATHYPNHLARHMKTHSGEK 386

  Fly   355 RYVCDICQASLKRKDHLTRHKQSHNPERPYICTVCLKAFKRKEQLSLHFVIHSGEKRHQCG---- 415
            .:.|..|..:....|:|.||::.|..|:||.|.:|..|......|..|..||||:|..:|.    
Human   387 PFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPLCPYACGNLANLKRHGRIHSGDKPFRCSLCNY 451

  Fly   416 ECGKGFYRKDHLRKHT 431
            .|.:....|.|:.:||
Human   452 SCNQSMNLKRHMLRHT 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
COG5048 356..>412 CDD:227381 20/55 (36%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..395 CDD:290200 10/24 (42%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)
zf-H2C2_2 399..423 CDD:290200 9/27 (33%)
zf-C2H2 412..434 CDD:278523 6/24 (25%)
C2H2 Zn finger 414..434 CDD:275368 6/22 (27%)
ZNF513NP_653232.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118
C2H2 Zn finger 152..172 CDD:275368
COG5048 176..>228 CDD:227381
C2H2 Zn finger 180..200 CDD:275368
zf-H2C2_2 192..217 CDD:316026
C2H2 Zn finger 208..228 CDD:275368
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
COG5048 <372..>450 CDD:227381 27/77 (35%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
COG5048 414..>487 CDD:227381 18/54 (33%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
C2H2 Zn finger 446..466 CDD:275368 4/19 (21%)
C2H2 Zn finger 474..493 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 492..541
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.